• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens collagen, type XI, alpha 1 (COL11A1), transcript variant B, mRNA.


RefSeq Accession Definition Services Price Order
NM_080629 Homo sapiens collagen, type XI, alpha 1 (COL11A1), transcript variant B, mRNA. ORF Sequence $2455.65
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_080629.2, 98985809
Length 7327 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens collagen, type XI, alpha 1 (COL11A1), transcript variant B, mRNA.
Product collagen alpha-1(XI) chain isoform B preproprotein
Comment

Summary: This gene encodes one of the two alpha chains of type XI collagen, a minor fibrillar collagen. Type XI collagen is a heterotrimer but the third alpha chain is a post-translationally modified alpha 1 type II chain. Mutations in this gene are associated with type II Stickler syndrome and with Marshall syndrome. A single-nucleotide polymorphism in this gene is also associated with susceptibility to lumbar disc herniation. Multiple transcript variants have been identified for this gene. [provided by RefSeq, Nov 2009].


Transcript Variant: This variant (B) utilizes alternate exon 6, designated exon 6B, and encodes the longest isoform (B). There are no publicly available transcripts representing this variant; it is supported by mRNA annotation on DNA accession AF101112.1, protein AAF04726.1, submitted by the authors of PMID:10486316.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The extent of this transcript is supported by transcript alignments.

RefSeq NP_542196.2
CDS 319..5775
Misc Feature(1)301..303
Misc Feature(2)535..993
Misc Feature(3)2677..2853
Misc Feature(4)2785..2964
Misc Feature(5)5131..5766
Exon (1)1..424
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (2)425..592
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (3)593..806
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (4)807..969
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (5)970..1098
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (6)1099..1251
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (7)1252..1344
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (8)1345..1599
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (9)1600..1662
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (10)1663..1704
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (11)1705..1767
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (12)1768..1842
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (13)1843..1926
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (14)1927..1983
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (15)1984..2037
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (16)2038..2091
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (17)2092..2145
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (18)2146..2199
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (19)2200..2253
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (20)2254..2298
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (21)2299..2352
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (22)2353..2397
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (23)2398..2451
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (24)2452..2496
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (25)2497..2550
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (26)2551..2595
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (27)2596..2649
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (28)2650..2694
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (29)2695..2748
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (30)2749..2856
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (31)2857..2910
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (32)2911..2964
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (33)2965..3009
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (34)3010..3063
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (35)3064..3108
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (36)3109..3162
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (37)3163..3216
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (38)3217..3270
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (39)3271..3378
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (40)3379..3468
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (41)3469..3522
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (42)3523..3630
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (43)3631..3738
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (44)3739..3792
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (45)3793..3846
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (46)3847..3954
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (47)3955..4008
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (48)4009..4062
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (49)4063..4116
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (50)4117..4170
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (51)4171..4278
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (52)4279..4332
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (53)4333..4386
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (54)4387..4440
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (55)4441..4494
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (56)4495..4602
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (57)4603..4656
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (58)4657..4710
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (59)4711..4818
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (60)4819..4872
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (61)4873..4908
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (62)4909..4962
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (63)4963..5212
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (64)5213..5325
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (65)5326..5394
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (66)5395..5628
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Exon (67)5629..7327
Gene:COL11A1
Gene Synonym:CO11A1; COLL6; STL2
Translation MEPWSSRWKTKRWLWDFTVTTLALTFLFQAREVRGAAPVDVLKALDFHNSPEGISKTTGF CTNRKNSKGSDTAYRVSKQAQLSAPTKQLFPGGTFPEDFSILFTVKPKKGIQSFLLSIYN EHGIQQIGVEVGRSPVFLFEDHTGKPAPEDYPLFRTVNIADGKWHRVAISVEKKTVTMIV DCKKKTTKPLDRSERAIVDTNGITVFGTRILDEEVFEGDIQQFLITGDPKAAYDYCEHYS PDCDSSAPKAAQAQEPQIDEKKKSNFKKKMRTVATKSKEKSKKFTPPKSEKFSSKKKKSY QASAKAKLGVKANIVDDFQEYNYGTMESYQTEAPRHVSGTNEPNPVEEIFTEEYLTGEDY DSQRKNSEDTLYENKEIDGRDSDLLVDGDLGEYDFYEYKEYEDKPTSPPNEEFGPGVPAE TDITETSINGHGAYGEKGQKGEPAVVEPGMLVEGPPGPAGPAGIMGPPGLQGPTGPPGDP GDRGPPGRPGLPGADGLPGPPGTMLMLPFRYGGDGSKGPTISAQEAQAQAILQQARIALR GPPGPMGLTGRPGPVGGPGSSGAKGESGDPGPQGPRGVQGPPGPTGKPGKRGRPGADGGR GMPGEPGAKGDRGFDGLPGLPGDKGHRGERGPQGPPGPPGDDGMRGEDGEIGPRGLPGEA GPRGLLGPRGTPGAPGQPGMAGVDGPPGPKGNMGPQGEPGPPGQQGNPGPQGLPGPQGPI GPPGEKGPQGKPGLAGLPGADGPPGHPGKEGQSGEKGALGPPGPQGPIGYPGPRGVKGAD GVRGLKGSKGEKGEDGFPGFKGDMGLKGDRGEVGQIGPRGEDGPEGPKGRAGPTGDPGPS GQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGVAGKPGPRGQRGPTGPR GSRGARGPTGKPGPKGTSGGDGPPGPPGERGPQGPQGPVGFPGPKGPPGPPGKDGLPGHP GQRGETGFQGKTGPPGPGGVVGPQGPTGETGPIGERGHPGPPGPPGEQGLPGAAGKEGAK GDPGPQGISGKDGPAGLRGFPGERGLPGAQGAPGLKGGEGPQGPPGPVGSPGERGSAGTA GPIGLPGRPGPQGPPGPAGEKGAPGEKGPQGPAGRDGVQGPVGLPGPAGPAGSPGEDGDK GEIGEPGQKGSKGDKGENGPPGPPGLQGPVGAPGIAGGDGEPGPRGQQGMFGQKGDEGAR GFPGPPGPIGLQGLPGPPGEKGENGDVGPMGPPGPPGPRGPQGPNGADGPQGPPGSVGSV GGVGEKGEPGEAGNPGPPGEAGVGGPKGERGEKGEAGPPGAAGPPGAKGPPGDDGPKGNP GPVGFPGDPGPPGEPGPAGQDGVGGDKGEDGDPGQPGPPGPSGEAGPPGPPGKRGPPGAA GAEGRQGEKGAKGEAGAEGPPGKTGPVGPQGPAGKPGPEGLRGIPGPVGEQGLPGAAGQD GPPGPMGPPGLPGLKGDPGSKGEKGHPGLIGLIGPPGEQGEKGDRGLPGTQGSPGAKGDG GIPGPAGPLGPPGPPGLPGPQGPKGNKGSTGPAGQKGDSGLPGPPGSPGPPGEVIQPLPI LSSKKTRRHTEGMQADADDNILDYSDGMEEIFGSLNSLKQDIEHMKFPMGTQTNPARTCK DLQLSHPDFPDGEYWIDPNQGCSGDSFKVYCNFTSGGETCIYPDKKSEGVRISSWPKEKP GSWFSEFKRGKLLSYLDVEGNSINMVQMTFLKLLTASARQNFTYHCHQSAAWYDVSSGSY DKALRFLGSNDEEMSYDNNPFIKTLYDGCASRKGYEKTVIEINTPKIDQVPIVDVMINDF GDQNQKFGFEVGPVCFLG
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(225)-dbSNP:
complement(225)-g, adbSNP:186714378
complement(241)-t, adbSNP:12025921
complement(340)-c, adbSNP:12025888
complement(370)-t, adbSNP:114630202
complement(448)-dbSNP:
complement(448)-t, cdbSNP:150090939
complement(456)-c, adbSNP:11164663
complement(457)-t, adbSNP:143159512
complement(464)-t, cdbSNP:145159429
complement(476)-t, cdbSNP:139542185
complement(512)-t, cdbSNP:200396868
complement(533)-g, cdbSNP:56230601
complement(622)-dbSNP:
complement(622)-g, adbSNP:143736758
complement(636)-t, cdbSNP:150668398
complement(646)-g, cdbSNP:141978499
complement(668)-g, cdbSNP:143396707
complement(670)-t, cdbSNP:202212358
complement(796)-t, cdbSNP:146954848
complement(815)-dbSNP:
complement(815)-c, adbSNP:142753283
complement(820)-t, cdbSNP:150144437
complement(878)-g, adbSNP:184606223
complement(883)-t, gdbSNP:201557468
complement(920)-t, cdbSNP:201647477
complement(929)-g, adbSNP:199595073
complement(978)-dbSNP:
complement(978)-g, adbSNP:71664966
complement(1000)-t, cdbSNP:143648039
complement(1016)-t, cdbSNP:141304474
complement(1142)-dbSNP:
complement(1142)-t, gdbSNP:200483544
complement(1146)-t, gdbSNP:12731843
complement(1166)-t, gdbSNP:148225616
complement(1175)-g, adbSNP:143966233
complement(1220)-t, cdbSNP:113951102
complement(1237)-t, cdbSNP:138054633
complement(1257)-dbSNP:
complement(1257)-t, g, adbSNP:112484990
complement(1258)-t, cdbSNP:75824519
complement(1282)-t, gdbSNP:201305757
complement(1319)-g, adbSNP:183130583
complement(1346)-dbSNP:
complement(1346)-g, adbSNP:148978696
complement(1375)-g, cdbSNP:144884147
complement(1393)-t, cdbSNP:199942159
complement(1417)-c, adbSNP:141036911
complement(1523)-t, cdbSNP:139480042
complement(1530)-t, cdbSNP:150533207
complement(1538)-t, cdbSNP:146246643
complement(1555)-t, adbSNP:141817156
complement(1674)-dbSNP:
complement(1674)-g, adbSNP:201585594
complement(1781)-dbSNP:
complement(1781)-t, cdbSNP:149558726
complement(1798)-t, cdbSNP:150428394
complement(1818)-g, adbSNP:28573735
complement(1850)-dbSNP:
complement(1850)-t, gdbSNP:147920779
complement(1860)-g, adbSNP:141770006
complement(1876)-t, cdbSNP:55851925
complement(1921)-t, cdbSNP:148610199
complement(2018)-dbSNP:
complement(2018)-t, cdbSNP:149894788
complement(2029)-t, cdbSNP:12143815
complement(2072)-dbSNP:
complement(2072)-g, adbSNP:202011565
complement(2080)-g, adbSNP:200177450
complement(2143)-dbSNP:
complement(2143)-t, adbSNP:76176516
complement(2148)-dbSNP:
complement(2148)-t, adbSNP:199986197
complement(2207)-dbSNP:
complement(2207)-t, cdbSNP:192313594
complement(2226)-t, cdbSNP:111841420
complement(2228)-t, gdbSNP:121912943
complement(2250)-t, cdbSNP:199835797
complement(2265)-dbSNP:
complement(2265)-t, cdbSNP:113101978
complement(2271)-t, adbSNP:199603326
complement(2280)-t, cdbSNP:142506188
complement(2302)-dbSNP:
complement(2302)-g, adbSNP:202080663
complement(2303)-g, cdbSNP:199875795
complement(2347)-t, gdbSNP:141812524
complement(2365)-dbSNP:
complement(2365)-t, cdbSNP:201602988
complement(2368)-t, cdbSNP:143663917
complement(2373)-t, gdbSNP:139117706
complement(2374)-g, adbSNP:201849355
complement(2504)-dbSNP:
complement(2504)-t, cdbSNP:142524348
complement(2506..2507)-, cdbSNP:34795186
complement(2523)-g, adbSNP:150469622
complement(2676)-dbSNP:
complement(2676)-t, cdbSNP:140608161
complement(2807)-dbSNP:
complement(2807)-t, cdbSNP:142523692
complement(2848)-c, adbSNP:12735019
complement(2932)-dbSNP:
complement(2932)-t, adbSNP:141548164
complement(3078)-dbSNP:
complement(3078)-g, cdbSNP:201972285
complement(3089)-g, adbSNP:192842970
complement(3120)-dbSNP:
complement(3120)-t, cdbSNP:139911745
complement(3132)-t, gdbSNP:200115284
complement(3144)-g, adbSNP:200778266
complement(3171)-dbSNP:
complement(3171)-t, adbSNP:1131486
complement(3255)-dbSNP:
complement(3255)-t, gdbSNP:149526015
complement(3275)-dbSNP:
complement(3275)-t, gdbSNP:78046647
complement(3281)-t, gdbSNP:121912944
complement(3305)-t, cdbSNP:147271219
complement(3310)-t, cdbSNP:1051071
complement(3318)-t, cdbSNP:1051072
complement(3387)-dbSNP:
complement(3387)-t, gdbSNP:143606220
complement(3438)-g, adbSNP:201595181
complement(3488)-dbSNP:
complement(3488)-g, cdbSNP:149000575
complement(3495)-t, adbSNP:140230238
complement(3543)-dbSNP:
complement(3543)-t, cdbSNP:75915098
complement(3548)-g, cdbSNP:150976349
complement(3581)-t, cdbSNP:148464130
complement(3583)-t, gdbSNP:144562769
complement(3585)-t, cdbSNP:147247206
complement(3663)-dbSNP:
complement(3663)-t, adbSNP:151004249
complement(3729)-g, adbSNP:17127270
complement(3747)-dbSNP:
complement(3747)-t, adbSNP:141514115
complement(3779)-g, adbSNP:1131487
complement(3801)-dbSNP:
complement(3801)-g, adbSNP:141432979
complement(3832)-t, cdbSNP:145253279
complement(3949)-dbSNP:
complement(3949)-g, cdbSNP:138507620
complement(3993)-dbSNP:
complement(3993)-t, cdbSNP:143651470
complement(4060)-dbSNP:
complement(4060)-t, cdbSNP:140292959
complement(4076)-dbSNP:
complement(4076)-g, adbSNP:151195708
complement(4083)-t, cdbSNP:148395062
complement(4129)-dbSNP:
complement(4129)-g, cdbSNP:148517780
complement(4143)-t, cdbSNP:144729226
complement(4165)-c, adbSNP:150669855
complement(4188)-dbSNP:
complement(4188)-t, cdbSNP:138466265
complement(4223)-g, cdbSNP:199555214
complement(4227)-t, gdbSNP:149367044
complement(4249)-g, adbSNP:200465040
complement(4292)-dbSNP:
complement(4292)-t, adbSNP:200014253
complement(4304)-g, cdbSNP:147993467
complement(4322)-t, cdbSNP:3753841
complement(4382)-dbSNP:
complement(4382)-t, g, cdbSNP:145997317
complement(4386)-t, cdbSNP:147637674
complement(4411)-dbSNP:
complement(4411)-t, cdbSNP:151249006
complement(4537)-dbSNP:
complement(4537)-t, cdbSNP:148748247
complement(4539)-g, adbSNP:112577505
complement(4576)-t, cdbSNP:200496207
complement(4587)-g, adbSNP:139726483
complement(4637)-dbSNP:
complement(4637)-t, cdbSNP:137860254
complement(4717)-dbSNP:
complement(4717)-g, adbSNP:184965786
complement(4734)-t, cdbSNP:180734278
complement(4742)-t, gdbSNP:202194245
complement(4770)-t, gdbSNP:55821405
complement(4822)-dbSNP:
complement(4822)-t, cdbSNP:145901197
complement(4849)-g, adbSNP:199952288
complement(4866)-t, cdbSNP:1763347
complement(4935)-dbSNP:
complement(4935)-t, adbSNP:146997967
complement(4940)-g, adbSNP:145692304
complement(4948)-g, cdbSNP:140954784
complement(4957)-g, adbSNP:1676486
complement(4960)-g, cdbSNP:139064549
complement(5016)-dbSNP:
complement(5016)-t, cdbSNP:200462060
complement(5019)-t, adbSNP:149516921
complement(5026)-t, cdbSNP:144404767
complement(5031)-t, cdbSNP:202048103
complement(5055)-g, adbSNP:138691968
complement(5072)-g, adbSNP:143531636
complement(5073)-g, adbSNP:3753842
complement(5124)-t, cdbSNP:2229783
complement(5156)-t, g, adbSNP:143206624
complement(5159)-t, cdbSNP:75495145
complement(5227)-dbSNP:
complement(5227)-c, adbSNP:78368739
complement(5303)-t, adbSNP:184088500
complement(5319)-c, adbSNP:74778421
complement(5422)-dbSNP:
complement(5422)-g, adbSNP:146837973
complement(5439)-t, cdbSNP:140605061
complement(5486)-g, adbSNP:139920081
complement(5490)-g, adbSNP:143001188
complement(5498)-t, adbSNP:199576799
complement(5552)-t, cdbSNP:140250347
complement(5626)-g, adbSNP:1131490
complement(5627)-t, gdbSNP:202065765
complement(5638)-dbSNP:
complement(5638)-t, cdbSNP:143486841
complement(5668)-t, gdbSNP:199848923
complement(5713)-t, cdbSNP:144510951
complement(5767)-g, adbSNP:1975916
complement(5792)-t, cdbSNP:190728953
complement(5880)-g, adbSNP:1031820
complement(5929)-g, adbSNP:11164626
complement(5976)-g, adbSNP:148602088
complement(6076)-t, cdbSNP:12731575
complement(6127)-t, gdbSNP:185578236
complement(6283)-t, cdbSNP:3088150
complement(6297)-g, adbSNP:1051092
complement(6336)-g, adbSNP:1051095
complement(6339)-g, adbSNP:1051096
complement(6388)-t, cdbSNP:190609187
complement(6407)-t, cdbSNP:74108029
complement(6440)-g, adbSNP:202039091
complement(6462)-g, adbSNP:186072680
complement(6479)-g, adbSNP:74108028
complement(6559)-t, cdbSNP:61813901
complement(6584)-g, adbSNP:143875783
complement(6643)-t, adbSNP:181037780
complement(6866)-t, adbSNP:41292523
complement(6880)-g, adbSNP:12073619
complement(6899)-t, adbSNP:149947533
complement(6958)-t, cdbSNP:9659030
complement(6978)-t, cdbSNP:190577885
complement(7039)-g, cdbSNP:186386193
complement(7049)-t, adbSNP:9659024
complement(7097)-t, cdbSNP:139810625
complement(7212)-t, adbSNP:181411000
Gene SymbolCOL11A1
Gene SynonymCO11A1; COLL6; STL2
Chromosome1
Locus Map1p21
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001190709 Homo sapiens collagen, type XI, alpha 1 (COL11A1), transcript variant E, mRNA. Full Length $3235.95
ORF Sequence $2386.80
NM_001854 Homo sapiens collagen, type XI, alpha 1 (COL11A1), transcript variant A, mRNA. Full Length $3280.95
ORF Sequence $2439.45
NM_080629 Homo sapiens collagen, type XI, alpha 1 (COL11A1), transcript variant B, mRNA. Full Length $3297.15
ORF Sequence $2455.65
NM_080630 Homo sapiens collagen, type XI, alpha 1 (COL11A1), transcript variant C, mRNA. Full Length $3132.00
ORF Sequence $2282.85
Title COL11A1 gene is associated with limbus vertebra in gymnasts .
Author Koyama,K., Nakazato,K., Min,S., Gushiken,K., Hatakeda,Y., Seo,K. and Hiranuma,K.
Journal Int J Sports Med 33 (7), 586-590 (2012)
Title Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture .
Author Estrada,K., Styrkarsdottir,U., Evangelou,E., Hsu,Y.H., Duncan,E.L., Ntzani,E.E., Oei,L., Albagha,O.M., Amin,N., Kemp,J.P., Koller,D.L., Li,G., Liu,C.T., Minster,R.L., Moayyeri,A., Vandenput,L., Willner,D., Xiao,S.M., Yerges-Armstrong,L.M., Zheng,H.F., Alonso,N., Eriksson,J., Kammerer,C.M., Kaptoge,S.K., Leo,P.J., Thorleifsson,G., Wilson,S.G., Wilson,J.F., Aalto,V., Alen,M., Aragaki,A.K., Aspelund,T., Center,J.R., Dailiana,Z., Duggan,D.J., Garcia,M., Garcia-Giralt,N., Giroux,S., Hallmans,G., Hocking,L.J., Husted,L.B., Jameson,K.A., Khusainova,R., Kim,G.S., Kooperberg,C., Koromila,T., Kruk,M., Laaksonen,M., Lacroix,A.Z., Lee,S.H., Leung,P.C., Lewis,J.R., Masi,L., Mencej-Bedrac,S., Nguyen,T.V., Nogues,X., Patel,M.S., Prezelj,J., Rose,L.M., Scollen,S., Siggeirsdottir,K., Smith,A.V., Svensson,O., Trompet,S., Trummer,O., van Schoor,N.M., Woo,J., Zhu,K., Balcells,S., Brandi,M.L., Buckley,B.M., Cheng,S., Christiansen,C., Cooper,C., Dedoussis,G., Ford,I., Frost,M., Goltzman,D., Gonzalez-Macias,J., Kahonen,M., Karlsson,M., Khusnutdinova,E., Koh,J.M., Kollia,P., Langdahl,B.L., Leslie,W.D., Lips,P., Ljunggren,O., Lorenc,R.S., Marc,J., Mellstrom,D., Obermayer-Pietsch,B., Olmos,J.M., Pettersson-Kymmer,U., Reid,D.M., Riancho,J.A., Ridker,P.M., Rousseau,F., Slagboom,P.E., Tang,N.L., Urreizti,R., Van Hul,W., Viikari,J., Zarrabeitia,M.T., Aulchenko,Y.S., Castano-Betancourt,M., Grundberg,E., Herrera,L., Ingvarsson,T., Johannsdottir,H., Kwan,T., Li,R., Luben,R., Medina-Gomez,C., Palsson,S.T., Reppe,S., Rotter,J.I., Sigurdsson,G., van Meurs,J.B., Verlaan,D., Williams,F.M., Wood,A.R., Zhou,Y., Gautvik,K.M., Pastinen,T., Raychaudhuri,S., Cauley,J.A., Chasman,D.I., Clark,G.R., Cummings,S.R., Danoy,P., Dennison,E.M., Eastell,R., Eisman,J.A., Gudnason,V., Hofman,A., Jackson,R.D., Jones,G., Jukema,J.W., Khaw,K.T., Lehtimaki,T., Liu,Y., Lorentzon,M., McCloskey,E., Mitchell,B.D., Nandakumar,K., Nicholson,G.C., Oostra,B.A., Peacock,M., Pols,H.A., Prince,R.L., Raitakari,O., Reid,I.R., Robbins,J., Sambrook,P.N., Sham,P.C., Shuldiner,A.R., Tylavsky,F.A., van Duijn,C.M., Wareham,N.J., Cupples,L.A., Econs,M.J., Evans,D.M., Harris,T.B., Kung,A.W., Psaty,B.M., Reeve,J., Spector,T.D., Streeten,E.A., Zillikens,M.C., Thorsteinsdottir,U., Ohlsson,C., Karasik,D., Richards,J.B., Brown,M.A., Stefansson,K., Uitterlinden,A.G., Ralston,S.H., Ioannidis,J.P., Kiel,D.P. and Rivadeneira,F.
Journal Nat. Genet. 44 (5), 491-501 (2012)
Title Characterization of a novel mouse monoclonal antibody, clone 1E8.33, highly specific for human procollagen 11A1, a tumor-associated stromal component .
Author Garcia-Ocana,M., Vazquez,F., Garcia-Pravia,C., Fuentes-Martinez,N., Menendez-Rodriguez,P., Fresno-Forcelledo,F., Barneo-Serra,L., Del Amo-Iribarren,J., Simon-Buela,L. and De Los Toyos,J.R.
Journal Int. J. Oncol. 40 (5), 1447-1454 (2012)
Title A recessive form of Marshall syndrome is caused by a mutation in the COL11A1 gene .
Author Khalifa,O., Imtiaz,F., Allam,R., Al-Hassnan,Z., Al-Hemidan,A., Al-Mane,K., Abuharb,G., Balobaid,A., Sakati,N., Hyland,J. and Al-Owain,M.
Journal J. Med. Genet. 49 (4), 246-248 (2012)
Title Splicing mutations of 54-bp exons in the COL11A1 gene cause Marshall syndrome, but other mutations cause overlapping Marshall/Stickler phenotypes .
Author Annunen,S., Korkko,J., Czarny,M., Warman,M.L., Brunner,H.G., Kaariainen,H., Mulliken,J.B., Tranebjaerg,L., Brooks,D.G., Cox,G.F., Cruysberg,J.R., Curtis,M.A., Davenport,S.L., Friedrich,C.A., Kaitila,I., Krawczynski,M.R., Latos-Bielenska,A., Mukai,S., Olsen,B.R., Shinno,N., Somer,M., Vikkula,M., Zlotogora,J., Prockop,D.J. and Ala-Kokko,L.
Journal Am. J. Hum. Genet. 65 (4), 974-983 (1999)
Title Alternative mRNA processing occurs in the variable region of the pro-alpha 1(XI) and pro-alpha 2(XI) collagen chains .
Author Zhidkova,N.I., Justice,S.K. and Mayne,R.
Journal J. Biol. Chem. 270 (16), 9486-9493 (1995)
Title Structural and functional analysis of the promoter of the human alpha 1(XI) collagen gene .
Author Yoshioka,H., Greenwel,P., Inoguchi,K., Truter,S., Inagaki,Y., Ninomiya,Y. and Ramirez,F.
Journal J. Biol. Chem. 270 (1), 418-424 (1995)
Title Pro-alpha 1(XI) collagen. Structure of the amino-terminal propeptide and expression of the gene in tumor cell lines .
Author Yoshioka,H. and Ramirez,F.
Journal J. Biol. Chem. 265 (11), 6423-6426 (1990)
Title Cloning and sequencing of pro-alpha 1 (XI) collagen cDNA demonstrates that type XI belongs to the fibrillar class of collagens and reveals that the expression of the gene is not restricted to cartilagenous tissue .
Author Bernard,M., Yoshioka,H., Rodriguez,E., Van der Rest,M., Kimura,T., Ninomiya,Y., Olsen,B.R. and Ramirez,F.
Journal J. Biol. Chem. 263 (32), 17159-17166 (1988)
Title Mapping of a human fibrillar collagen gene, pro alpha 1 (XI) (COL11A1), to the p21 region of chromosome 1 .
Author Henry,I., Bernheim,A., Bernard,M., van der Rest,M., Kimura,T., Jeanpierre,C., Barichard,F., Berger,R., Olsen,B.R., Ramirez,F. et al.
Journal Genomics 3 (1), 87-90 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878