• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens solute carrier family 46 (folate transporter), member 1 (SLC46A1), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_080669 Homo sapiens solute carrier family 46 (folate transporter), member 1 (SLC46A1), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $699.00 18

*Business Day

Related Services

RefSeq Version NM_080669.5, 530788234
Length 6510 bp
Structure linear
Update Date 20-APR-2014
Organism Homo sapiens (human)
Definition Homo sapiens solute carrier family 46 (folate transporter), member 1 (SLC46A1), transcript variant 1, mRNA.
Product proton-coupled folate transporter isoform 1
Comment

Summary: This gene encodes a transmembrane proton-coupled folate transporter protein that facilitates the movement of folate and antifolate substrates across cell membranes, optimally in acidic pH environments. This protein is also expressed in the brain and choroid plexus where it transports folates into the central nervous system. This protein further functions as a heme transporter in duodenal enterocytes, and potentially in other tissues like liver and kidney. Its localization to the apical membrane or cytoplasm of intestinal cells is modulated by dietary iron levels. Mutations in this gene are associated with autosomal recessive hereditary folate malabsorption disease. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Aug 2013].


Transcript Variant: This variant (1, also known as HCP-1A) encodes the longer protein (isoform 1).

RefSeq NP_542400.2
CDS 99..1478
Misc Feature(1)99..101
Misc Feature(2)99..101
Misc Feature(3)315..1427
Misc Feature(4)order(315..317,366..368,375..380,387..389,399..404,
Misc Feature(5)357..419
Misc Feature(6)378..1319
Misc Feature(7)441..503
Misc Feature(8)543..605
Misc Feature(9)645..707
Misc Feature(10)729..791
Misc Feature(11)897..959
Misc Feature(12)1005..1073
Misc Feature(13)1107..1169
Misc Feature(14)1173..1235
Misc Feature(15)1266..1328
Misc Feature(16)1365..1427
Misc Feature(17)1470..1472
Exon (1)1..326
Gene:SLC46A1
Gene Synonym:G21; HCP1; PCFT
Exon (2)327..1179
Gene:SLC46A1
Gene Synonym:G21; HCP1; PCFT
Exon (3)1180..1263
Gene:SLC46A1
Gene Synonym:G21; HCP1; PCFT
Exon (4)1264..1420
Gene:SLC46A1
Gene Synonym:G21; HCP1; PCFT
Exon (5)1421..6492
Gene:SLC46A1
Gene Synonym:G21; HCP1; PCFT
Translation MEGSASPPEKPRARPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWHRFSADLGYNGT RQRGGCSNRSADPTMQEVETLTSHWTLYMNVGGFLVGLFSSTLLGAWSDSVGRRPLLVLA SLGLLLQALVSVFVVQLQLHVGYFVLGRILCALLGDFGGLLAASFASVADVSSSRSRTFR MALLEASIGVAGMLASLLGGHWLRAQGYANPFWLALALLIAMTLYAAFCFGETLKEPKST RLFTFRHHRSIVQLYVAPAPEKSRKHLALYSLAIFVVITVHFGAQDILTLYELSTPLCWD SKLIGYGSAAQHLPYLTSLLALKLLQYCLADAWVAEIGLAFNILGMVVFAFATITPLMFT GYGLLFLSLVITPVIRAKLSKLVRETEQGALFSAVACVNSLAMLTASGIFNSLYPATLNF MKGFPFLLGAGLLLIPAVLIGMLEKADPHLEFQQFPQSP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(116)-g, adbSNP:375478405
120+c, tdbSNP:41297065
121..122+, cdbSNP:397515574
183+a, gdbSNP:41297067
complement(195)-t, adbSNP:368562168
256+c, tdbSNP:41297069
287+c, g, tdbSNP:41297071
complement(291)-c, adbSNP:375000218
292..293+, gdbSNP:397515573
292+, gdbSNP:80338769
295..296+aa, gcdbSNP:154623632
302..303+, ccdbSNP:397515391
complement(322)-g, adbSNP:375346186
complement(375)-dbSNP:
complement(375)-t, cdbSNP:374179004
complement(392)-t, gdbSNP:371270310
complement(393)-g, adbSNP:201862124
complement(427)-t, cdbSNP:201076728
435+a, c, tdbSNP:80338770
complement(439)-t, cdbSNP:369959215
complement(464)-t, cdbSNP:372432334
complement(476)-g, adbSNP:375678730
complement(487)-g, adbSNP:369191223
complement(512)-t, cdbSNP:376191377
complement(524)-g, cdbSNP:61732735
537+c, gdbSNP:80338771
564+g, tdbSNP:281875210
complement(610)-t, adbSNP:189103810
complement(692)-g, adbSNP:375741617
complement(721)-t, adbSNP:201837257
complement(730)-g, adbSNP:368657591
complement(740)-t, cdbSNP:145398587
complement(761)-g, adbSNP:371702390
complement(819)-g, adbSNP:374760186
828+a, tdbSNP:41297081
complement(834)-g, adbSNP:370673122
complement(854)-g, cdbSNP:185900287
complement(862)-t, cdbSNP:374413378
complement(873)-t, cdbSNP:370955621
complement(975)-g, adbSNP:376504291
complement(981)-t, cdbSNP:34552966
complement(991)-t, cdbSNP:369228677
complement(996)-t, cdbSNP:201540617
complement(1010)-g, adbSNP:181338421
1052+c, gdbSNP:80338772
complement(1070)-g, adbSNP:188529539
complement(1088)-g, adbSNP:35257694
1102+a, cdbSNP:281875208
complement(1109)-g, adbSNP:141883705
1110+c, gdbSNP:281875209
complement(1170)-t, cdbSNP:369804471
complement(1215)-dbSNP:
complement(1215)-g, cdbSNP:75413886
1220+c, tdbSNP:41297095
1224+c, tdbSNP:80338773
1225+a, gdbSNP:281875211
complement(1303)-dbSNP:
complement(1303)-g, adbSNP:374232525
complement(1306)-g, adbSNP:199727773
complement(1324)-t, adbSNP:201732528
complement(1325)-, gdbSNP:374502830
complement(1325)-g, adbSNP:199895119
complement(1327)-g, adbSNP:201932339
complement(1354)-t, cdbSNP:141992236
1372+c, gdbSNP:80338774
complement(1400)-g, adbSNP:368561206
complement(1406)-t, cdbSNP:374545871
complement(1446)-dbSNP:
complement(1446)-g, adbSNP:370669989
complement(1464)-g, adbSNP:186143284
complement(1513)-g, adbSNP:369588539
1538+g, tdbSNP:41297121
complement(1557)-t, cdbSNP:116665535
complement(1601)-g, adbSNP:374837686
complement(1603)-c, adbSNP:370359894
complement(1712)-g, cdbSNP:4990808
complement(1835)-g, adbSNP:376235723
complement(1939)-g, adbSNP:148132817
complement(2078)-g, adbSNP:374394308
2149+c, tdbSNP:41297123
complement(2170)-t, adbSNP:112801276
2194+c, tdbSNP:147958365
complement(2207)-g, adbSNP:41297903
2276+a, cdbSNP:41297905
complement(2291)-g, adbSNP:142005271
complement(2313)-t, cdbSNP:181698246
2406+a, gdbSNP:2239907
complement(2491)-t, cdbSNP:144940240
complement(2522)-t, cdbSNP:149896785
2537+a, tdbSNP:41297907
complement(2554)-t, cdbSNP:151184490
complement(2590)-g, adbSNP:1055191
complement(2591)-g, adbSNP:1055190
complement(2629)-t, adbSNP:62065282
2721+a, gdbSNP:41297909
complement(2776)-t, cdbSNP:139970165
complement(2788)-g, adbSNP:370834754
complement(2810)-t, cdbSNP:146041886
complement(2863)-g, cdbSNP:369226733
2870+g, tdbSNP:141940033
2885+c, tdbSNP:2239908
2986+, cdbSNP:41297911
complement(3118)-t, cdbSNP:189069712
complement(3126)-t, cdbSNP:114008979
3186+a, cdbSNP:41297913
complement(3252)-g, adbSNP:2239909
complement(3270)-g, cdbSNP:370430108
complement(3272)-g, cdbSNP:377025828
complement(3273..3274)-, tgcdbSNP:56200575
complement(3273)-t, gdbSNP:200529579
complement(3274..3275)-, gct, tgcdbSNP:34137807
3309+a, cdbSNP:41297915
3317+a, gdbSNP:41297917
complement(3355)-t, adbSNP:186516852
complement(3420)-t, cdbSNP:144246026
3459+c, gdbSNP:41297919
3505+g, tdbSNP:149579635
3550+c, gdbSNP:41297921
complement(3601)-g, cdbSNP:7225850
complement(3695)-g, adbSNP:41297923
complement(3702)-g, cdbSNP:147076381
complement(3726)-g, adbSNP:8082600
complement(3739)-g, adbSNP:143263583
complement(3793)-t, adbSNP:1133693
complement(4202)-g, cdbSNP:139343092
complement(4224)-t, cdbSNP:11871687
complement(4320)-t, cdbSNP:146914333
complement(4321)-t, cdbSNP:118138669
4331+a, gdbSNP:739439
complement(4331)-g, adbSNP:386609735
complement(4375)-t, cdbSNP:376935474
4420+c, tdbSNP:756767
complement(4446)-g, adbSNP:12453383
4487+g, tdbSNP:2239910
4540+a, cdbSNP:2239911
complement(4598)-t, cdbSNP:147971222
complement(4705)-t, cdbSNP:56736971
complement(4706)-c, adbSNP:148837601
complement(4712)-t, cdbSNP:189192075
complement(4744)-t, cdbSNP:73273104
complement(4804)-t, cdbSNP:145537060
complement(4829)-g, cdbSNP:372019717
complement(4845)-t, adbSNP:367878633
complement(4847)-g, cdbSNP:374297439
complement(4856)-t, cdbSNP:61456782
complement(4857)-t, gdbSNP:61629513
complement(4867)-t, cdbSNP:146812537
complement(4870)-t, cdbSNP:368545564
complement(4908)-g, cdbSNP:376014977
complement(4929)-t, cdbSNP:371027401
complement(4934)-g, cdbSNP:372946020
complement(4978)-g, adbSNP:370737918
complement(5022..5023)-tc, aadbSNP:386796350
complement(5022)-c, adbSNP:376312972
complement(5023)-t, adbSNP:368855743
complement(5065)-t, cdbSNP:184347910
complement(5070)-t, cdbSNP:373384753
complement(5079)-g, adbSNP:369610556
complement(5084)-g, adbSNP:376463203
complement(5116)-t, cdbSNP:371818392
complement(5152)-t, cdbSNP:143705142
complement(5155)-, gdbSNP:36001053
complement(5259)-t, gdbSNP:369471535
complement(5263)-g, adbSNP:117451747
complement(5425)-t, cdbSNP:8081240
complement(5508)-g, adbSNP:8079943
complement(5541)-g, adbSNP:192565566
complement(5727)-g, adbSNP:373568389
complement(5729)-g, cdbSNP:371761830
complement(5790)-g, adbSNP:189459886
complement(5794)-g, cdbSNP:117397871
complement(5843)-g, adbSNP:368123395
complement(5896)-g, adbSNP:184621509
complement(6062)-g, adbSNP:116278566
complement(6113..6114)-, adbSNP:34879232
6258+c, tdbSNP:1128161
complement(6351)-g, cdbSNP:143365131
6362+g, tdbSNP:1128162
complement(6434)-t, adbSNP:368270883
complement(6447)-g, adbSNP:114943936
Gene SymbolSLC46A1
Gene SynonymG21; HCP1; PCFT
Chromosome17
Locus Map17q11.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_080669 Homo sapiens solute carrier family 46 (folate transporter), member 1 (SLC46A1), transcript variant 1, mRNA. On-demand $699.00 18
NM_001242366 Homo sapiens solute carrier family 46 (folate transporter), member 1 (SLC46A1), transcript variant 2, mRNA. On-demand $699.00 18
XM_005277786 PREDICTED: Homo sapiens solute carrier family 46 (folate transporter), member 1 (SLC46A1), transcript variant X1, mRNA. On-demand $549.00 14
Title Inhibition of the proton-coupled folate transporter (PCFT-SLC46A1) by bicarbonate and other anions .
Author Zhao R, Visentin M, Suadicani SO and Goldman ID.
Journal Mol. Pharmacol. 84 (1), 95-103 (2013)
Title Role of the fourth transmembrane domain in proton-coupled folate transporter function as assessed by the substituted cysteine accessibility method .
Author Shin DS, Zhao R, Fiser A and Goldman ID.
Journal Am. J. Physiol., Cell Physiol. 304 (12), C1159-C1167 (2013)
Title The monomeric state of the proton-coupled folate transporter represents the functional unit in the plasma membrane .
Author Duddempudi PK, Nakashe P, Blanton MP and Jansen M.
Journal FEBS J. 280 (12), 2900-2915 (2013)
Title Single nucleotide polymorphisms in CETP, SLC46A1, SLC19A1, CD36, BCMO1, APOA5, and ABCA1 are significant predictors of plasma HDL in healthy adults .
Author Clifford AJ, Rincon G, Owens JE, Medrano JF, Moshfegh AJ, Baer DJ and Novotny JA.
Journal Lipids Health Dis 12, 66 (2013)
Title Heme carrier protein (HCP-1) spatially interacts with the CD163 hemoglobin uptake pathway and is a target of inflammatory macrophage activation .
Author Schaer CA, Vallelian F, Imhof A, Schoedon G and Schaer DJ.
Journal J. Leukoc. Biol. 83 (2), 325-333 (2008)
Title Heme carrier protein 1 (HCP1) expression and functional analysis in the retina and retinal pigment epithelium .
Author Sharma S, Dimasi D, Broer S, Kumar R and Della NG.
Journal Exp. Cell Res. 313 (6), 1251-1259 (2007)
Title Haem carrier protein 1 (HCP1): Expression and functional studies in cultured cells .
Author Latunde-Dada GO, Takeuchi K, Simpson RJ and McKie AT.
Journal FEBS Lett. 580 (30), 6865-6870 (2006)
Title Identification of an intestinal folate transporter and the molecular basis for hereditary folate malabsorption .
Author Qiu A, Jansen M, Sakaris A, Min SH, Chattopadhyay S, Tsai E, Sandoval C, Zhao R, Akabas MH and Goldman ID.
Journal Cell 127 (5), 917-928 (2006)
Title Identification of an intestinal heme transporter .
Author Shayeghi M, Latunde-Dada GO, Oakhill JS, Laftah AH, Takeuchi K, Halliday N, Khan Y, Warley A, McCann FE, Hider RC, Frazer DM, Anderson GJ, Vulpe CD, Simpson RJ and McKie AT.
Journal Cell 122 (5), 789-801 (2005)
Title Hereditary Folate Malabsorption .
Author Diop-Bove,N., Kronn,D. and Goldman,I.D.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.