• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens GS homeobox 2 (GSX2), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu31865 Homo sapiens GS homeobox 2 (GSX2), mRNA. pcDNA3.1+-DYK On-demand $159.00 7-9
OHu31865C Homo sapiens GS homeobox 2 (GSX2), mRNA. Customized vector On-demand $209.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_133267.2, 193211415
Length 915 bp
Structure linear
Update Date 02-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens GS homeobox 2 (GSX2), mRNA.
Product GS homeobox 2
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from EU596451.1, BC075090.2 and AI360912.1. On Jun 28, 2008 this sequence version replaced gi:18959211.


##Evidence-Data-START## Transcript exon combination :: AB028838.1, BC075090.2 [ECO:0000332] ##Evidence-Data-END##

RefSeq NP_573574.1
CDS 265..1179
Misc Feature(1)208..210
Misc Feature(2)871..1044
Misc Feature(3)871..1044
Misc Feature(4)order(871..885,889..891,940..942,958..960,997..999,
Misc Feature(5)order(877..879,886..888,1006..1008,1015..1020,1027..1029)
Exon (1)1..838
Gene:GSX2
Gene Synonym:GSH2
Exon (2)839..1212
Gene:GSX2
Gene Synonym:GSH2
Translation MSRSFYVDSLIIKDTSRPAPSLPEPHPGPDFFIPLGMPPPLVMSVSGPGCPSRKSGAFCV CPLCVTSHLHSSRGSVGAGSGGAGAGVTGAGGSGVAGAAGALPLLKSQFSSAPGDAQFCP RVNHAHHHHHPPQHHHHHHQPQQPGSAAAAAAAAAAAAAAAALGHPQHHAPVCTATTYNV ADPRRFHCLTMGGSDASQVPNGKRMRTAFTSTQLLELEREFSSNMYLSRLRRIEIATYLN LSEKQVKIWFQNRRVKHKKEGKGTQRNSHAGCKCVGSQVHYARSEDEDSLSPASANDDKE ISPL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
47+dbSNP:
47+a, gdbSNP:368553397
221+g, tdbSNP:370144954
225+c, tdbSNP:375280653
228+a, gdbSNP:367974428
272+g, tdbSNP:377377329
273+a, cdbSNP:140713069
285+a, cdbSNP:144560606
298+a, gdbSNP:145597698
310+a, tdbSNP:201536623
324+c, gdbSNP:148460532
397+c, gdbSNP:371417798
403+c, gdbSNP:200996880
408+c, tdbSNP:370613209
420+c, tdbSNP:3194383
428+a, gdbSNP:150979273
432+c, tdbSNP:140790882
446+a, gdbSNP:371317920
482+c, gdbSNP:375038462
583+a, gdbSNP:13144341
672+c, tdbSNP:1132998
726+a, gdbSNP:371991245
885+dbSNP:
885+c, gdbSNP:368607199
888+c, g, tdbSNP:61737615
947+c, tdbSNP:374243147
969+a, cdbSNP:201527645
1008+a, cdbSNP:181479968
1043+a, gdbSNP:200779011
1062+a, gdbSNP:144670003
1107+c, tdbSNP:146677175
1108+c, gdbSNP:140212063
1147+a, gdbSNP:145163904
1152+c, gdbSNP:187314393
1206+a, cdbSNP:141885097
Gene SymbolGSX2
Gene SynonymGSH2
Chromosome4
Locus Map4q12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_133267 Homo sapiens GS homeobox 2 (GSX2), mRNA. On-demand TBD TBD
Title The homeobox gene Gsx2 regulates the self-renewal and differentiation of neural stem cells and the cell fate of postnatal progenitors .
Author Mendez-Gomez HR and Vicario-Abejon C.
Journal PLoS ONE 7 (1), E29799 (2012)
Title MicroRNA-9 regulates neurogenesis in mouse telencephalon by targeting multiple transcription factors .
Author Shibata M, Nakao H, Kiyonari H, Abe T and Aizawa S.
Journal J. Neurosci. 31 (9), 3407-3422 (2011)
Title Distinct temporal requirements for the homeobox gene Gsx2 in specifying striatal and olfactory bulb neuronal fates .
Author Waclaw RR, Wang B, Pei Z, Ehrman LA and Campbell K.
Journal Neuron 63 (4), 451-465 (2009)
Title Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening .
Author Wu C, Ma MH, Brown KR, Geisler M, Li L, Tzeng E, Jia CY, Jurisica I and Li SS.
Journal Proteomics 7 (11), 1775-1785 (2007)
Title Heterozygous truncating mutation in the human homeobox gene GSH2 has no discernable phenotypic effect .
Author Dauwerse,J.G., De Die-Smulders,C.E., Bakker,E., Breuning,M.H. and Peters,D.J.
Journal J. Med. Genet. 39 (9), 686-688 (2002)
Title Evidence for position effects as a variant ETV6-mediated leukemogenic mechanism in myeloid leukemias with a t(4;12)(q11-q12;p13) or t(5;12)(q31;p13) .
Author Cools J, Mentens N, Odero MD, Peeters P, Wlodarska I, Delforge M, Hagemeijer A and Marynen P.
Journal Blood 99 (5), 1776-1784 (2002)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.