Homo sapiens GS homeobox 2 (GSX2), mRNA.
| RefSeq Version | NM_133267.2, 193211415 |
| Length | 1212 bp |
| Structure | linear |
| Update Date | 12-MAR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens GS homeobox 2 (GSX2), mRNA. |
| Product | GS homeobox 2 |
| Comment | COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from EU596451.1, BC075090.2 and AI360912.1. On Jun 28, 2008 this sequence version replaced gi:18959211. |
| RefSeq | NP_573574.1 |
| CDS | 265..1179 | Exon (1) | 1..838 | Exon (2) | 1..838 | Exon (3) | 839..1212 |
| Translation | MSRSFYVDSLIIKDTSRPAPSLPEPHPGPDFFIPLGMPPPLVMSVSGPGCPSRKSGAFCV
CPLCVTSHLHSSRGSVGAGSGGAGAGVTGAGGSGVAGAAGALPLLKSQFSSAPGDAQFCP
RVNHAHHHHHPPQHHHHHHQPQQPGSAAAAAAAAAAAAAAAALGHPQHHAPVCTATTYNV
ADPRRFHCLTMGGSDASQVPNGKRMRTAFTSTQLLELEREFSSNMYLSRLRRIEIATYLN
LSEKQVKIWFQNRRVKHKKEGKGTQRNSHAGCKCVGSQVHYARSEDEDSLSPASANDDKE
ISPL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| 216 | + | a, g | dbSNP:74583098 |
| 420 | + | c, t | dbSNP:3194383 |
| 583 | + | a, g | dbSNP:13144341 |
| 672 | + | c, t | dbSNP:1132998 |
| 888 | + | c, g | dbSNP:61737615 |
| Title | Distinct temporal requirements for the homeobox gene Gsx2 in specifying striatal and olfactory bulb neuronal fates . |
| Author | Waclaw,R.R., Wang,B., Pei,Z., Ehrman,L.A. and Campbell,K. |
| Journal | Neuron 63 (4), 451-465 (2009) |
| Title | Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening . |
| Author | Wu,C., Ma,M.H., Brown,K.R., Geisler,M., Li,L., Tzeng,E., Jia,C.Y., Jurisica,I. and Li,S.S. |
| Journal | Proteomics 7 (11), 1775-1785 (2007) |
| Title | Heterozygous truncating mutation in the human homeobox gene GSH2 has no discernable phenotypic effect . |
| Author | Dauwerse,J.G., De Die-Smulders,C.E., Bakker,E., Breuning,M.H. and Peters,D.J. |
| Journal | J. Med. Genet. 39 (9), 686-688 (2002) |
| Title | Evidence for position effects as a variant ETV6-mediated leukemogenic mechanism in myeloid leukemias with a t(4;12)(q11-q12;p13) or t(5;12)(q31;p13) . |
| Author | Cools,J., Mentens,N., Odero,M.D., Peeters,P., Wlodarska,I., Delforge,M., Hagemeijer,A. and Marynen,P. |
| Journal | Blood 99 (5), 1776-1784 (2002) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |