• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens exocyst complex component 3-like 2 (EXOC3L2), mRNA.


RefSeq Accession Definition Services Price Order
NM_138568 Homo sapiens exocyst complex component 3-like 2 (EXOC3L2), mRNA. ORF Sequence $356.70
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_138568.3, 226371707
Length 1719 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens exocyst complex component 3-like 2 (EXOC3L2), mRNA.
Product exocyst complex component 3-like protein 2
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK093466.1, BC104947.1 and AA069926.1. On Apr 4, 2009 this sequence version replaced gi:29788775.


##Evidence-Data-START## Transcript exon combination :: AK093466.1, AK225791.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025086, ERS025091 [ECO:0000348] ##Evidence-Data-END##

RefSeq NP_612635.3
CDS 42..1271
Misc Feature(1)<63..1106
Misc Feature(2)<63..1106
Exon (1)1..19
Gene:EXOC3L2
Gene Synonym:XTP7
Exon (2)20..131
Gene:EXOC3L2
Gene Synonym:XTP7
Exon (3)132..233
Gene:EXOC3L2
Gene Synonym:XTP7
Exon (4)234..334
Gene:EXOC3L2
Gene Synonym:XTP7
Exon (5)335..445
Gene:EXOC3L2
Gene Synonym:XTP7
Exon (6)446..581
Gene:EXOC3L2
Gene Synonym:XTP7
Exon (7)582..704
Gene:EXOC3L2
Gene Synonym:XTP7
Exon (8)705..860
Gene:EXOC3L2
Gene Synonym:XTP7
Exon (9)861..982
Gene:EXOC3L2
Gene Synonym:XTP7
Exon (10)983..1719
Gene:EXOC3L2
Gene Synonym:XTP7
Translation MAALENGELGPLLSPGTLRGLEDECVTDVKAQTRAALLRVLQEDEEHWGSLEDQPSSLAQ DVCELLEEHTERAPRISQEFGERMAHCCLGGLAEFLQSFQQRVERFHENPAVREMLPDTY ISKTIALVNCGPPLRALAERLARVGPPESEPAREASASALDHVTRLCHRVVANLLFQELQ PHFNKLMRRKWLSSPEALDGIVGTLGAQALALRRMQDEPYQALVAELHRRALVEYVRPLL RGRLRCSSARTRSRVAGRLREDAAQLQRLFRRLESQASWLDAVVPHLAEVMQLEDTPSIQ VEVGVLVRDYPDIRQKHVAALLDIRGLRNTAARQEILAVARDLELSEEGALSPPRDRAFF ADIPVPRPSFCLSLPLFLGRLPLSRLARPSLACLPRPRPPSLARPRAQR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(47)-g, adbSNP:138262010
complement(48)-t, cdbSNP:202064916
complement(62)-t, cdbSNP:201110701
complement(141)-dbSNP:
complement(141)-t, gdbSNP:75426681
complement(157)-t, cdbSNP:143269965
complement(173)-g, adbSNP:187345620
complement(215)-c, adbSNP:148354060
complement(256)-dbSNP:
complement(256)-t, cdbSNP:143336723
complement(264)-g, adbSNP:73939819
complement(288)-g, adbSNP:138431712
complement(346)-dbSNP:
complement(346)-t, cdbSNP:139655836
complement(350)-t, cdbSNP:140822467
complement(359)-t, gdbSNP:201323099
complement(379)-t, cdbSNP:146408436
complement(400)-t, cdbSNP:144153757
complement(431)-g, adbSNP:140390935
complement(459)-dbSNP:
complement(459)-g, adbSNP:202169742
complement(469)-t, cdbSNP:151207947
complement(494)-t, cdbSNP:10410003
complement(524)-g, adbSNP:148752580
complement(528)-t, cdbSNP:200984629
complement(535)-t, cdbSNP:145255138
complement(547)-t, cdbSNP:145422378
complement(558)-t, cdbSNP:10411314
complement(563)-t, cdbSNP:147446751
complement(603)-dbSNP:
complement(603)-g, adbSNP:143444923
complement(626)-t, cdbSNP:139986634
complement(652)-g, adbSNP:202199122
complement(849)-dbSNP:
complement(849)-c, adbSNP:79187950
complement(861)-dbSNP:
complement(861)-, cdbSNP:11341353
complement(887)-g, adbSNP:34958174
complement(965)-g, adbSNP:141938500
complement(1049)-dbSNP:
complement(1049)-g, adbSNP:148132329
complement(1068)-g, cdbSNP:201048859
complement(1127)-t, gdbSNP:111862689
complement(1131)-g, cdbSNP:142412403
complement(1209)-t, cdbSNP:181444579
complement(1234)-t, cdbSNP:189063316
complement(1241)-t, cdbSNP:200836902
complement(1250)-t, cdbSNP:201597405
complement(1252)-t, cdbSNP:199587359
complement(1257)-g, adbSNP:199861385
complement(1296)-c, adbSNP:200809286
complement(1315)-t, cdbSNP:185860487
complement(1401)-g, adbSNP:11667430
complement(1406)-g, cdbSNP:11667509
complement(1442)-t, cdbSNP:114087746
complement(1602)-t, gdbSNP:143393432
complement(1622)-g, adbSNP:3803906
Gene SymbolEXOC3L2
Gene SynonymXTP7
Chromosome19
Locus Map19q13.32
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_138568 Homo sapiens exocyst complex component 3-like 2 (EXOC3L2), mRNA. Full Length $498.51
ORF Sequence $356.70
Title Lack of association between rs597668 polymorphism near EXOC3L2 and late-onset Alzheimer's disease in Han Chinese .
Author Liu,Q.Y., Miao,D., Yu,J.T., Xing,Y.Y., Zhong,X.L., Wu,Z.C., Zhang,Q. and Tan,L.
Journal Neurosci. Lett. 513 (2), 174-177 (2012)
Title New gene functions in megakaryopoiesis and platelet formation .
Author Gieger,C., Radhakrishnan,A., Cvejic,A., Tang,W., Porcu,E., Pistis,G., Serbanovic-Canic,J., Elling,U., Goodall,A.H., Labrune,Y., Lopez,L.M., Magi,R., Meacham,S., Okada,Y., Pirastu,N., Sorice,R., Teumer,A., Voss,K., Zhang,W., Ramirez-Solis,R., Bis,J.C., Ellinghaus,D., Gogele,M., Hottenga,J.J., Langenberg,C., Kovacs,P., O'Reilly,P.F., Shin,S.Y., Esko,T., Hartiala,J., Kanoni,S., Murgia,F., Parsa,A., Stephens,J., van der Harst,P., Ellen van der Schoot,C., Allayee,H., Attwood,A., Balkau,B., Bastardot,F., Basu,S., Baumeister,S.E., Biino,G., Bomba,L., Bonnefond,A., Cambien,F., Chambers,J.C., Cucca,F., D'Adamo,P., Davies,G., de Boer,R.A., de Geus,E.J., Doring,A., Elliott,P., Erdmann,J., Evans,D.M., Falchi,M., Feng,W., Folsom,A.R., Frazer,I.H., Gibson,Q.D., Glazer,N.L., Hammond,C., Hartikainen,A.L., Heckbert,S.R., Hengstenberg,C., Hersch,M., Illig,T., Loos,R.J., Jolley,J., Khaw,K.T., Kuhnel,B., Kyrtsonis,M.C., Lagou,V., Lloyd-Jones,H., Lumley,T., Mangino,M., Maschio,A., Mateo Leach,I., McKnight,B., Memari,Y., Mitchell,B.D., Montgomery,G.W., Nakamura,Y., Nauck,M., Navis,G., Nothlings,U., Nolte,I.M., Porteous,D.J., Pouta,A., Pramstaller,P.P., Pullat,J., Ring,S.M., Rotter,J.I., Ruggiero,D., Ruokonen,A., Sala,C., Samani,N.J., Sambrook,J., Schlessinger,D., Schreiber,S., Schunkert,H., Scott,J., Smith,N.L., Snieder,H., Starr,J.M., Stumvoll,M., Takahashi,A., Tang,W.H., Taylor,K., Tenesa,A., Lay Thein,S., Tonjes,A., Uda,M., Ulivi,S., van Veldhuisen,D.J., Visscher,P.M., Volker,U., Wichmann,H.E., Wiggins,K.L., Willemsen,G., Yang,T.P., Hua Zhao,J., Zitting,P., Bradley,J.R., Dedoussis,G.V., Gasparini,P., Hazen,S.L., Metspalu,A., Pirastu,M., Shuldiner,A.R., Joost van Pelt,L., Zwaginga,J.J., Boomsma,D.I., Deary,I.J., Franke,A., Froguel,P., Ganesh,S.K., Jarvelin,M.R., Martin,N.G., Meisinger,C., Psaty,B.M., Spector,T.D., Wareham,N.J., Akkerman,J.W., Ciullo,M., Deloukas,P., Greinacher,A., Jupe,S., Kamatani,N., Khadake,J., Kooner,J.S., Penninger,J., Prokopenko,I., Stemple,D., Toniolo,D., Wernisch,L., Sanna,S., Hicks,A.A., Rendon,A., Ferreira,M.A., Ouwehand,W.H. and Soranzo,N.
Journal Nature 480 (7376), 201-208 (2011)
Title Exocyst complex component 3-like 2 (EXOC3L2) associates with the exocyst complex and mediates directional migration of endothelial cells .
Author Barkefors,I., Fuchs,P.F., Heldin,J., Bergstrom,T., Forsberg-Nilsson,K. and Kreuger,J.
Journal J. Biol. Chem. 286 (27), 24189-24199 (2011)
Title Genome-wide analysis of genetic loci associated with Alzheimer disease .
Author Seshadri,S., Fitzpatrick,A.L., Ikram,M.A., DeStefano,A.L., Gudnason,V., Boada,M., Bis,J.C., Smith,A.V., Carassquillo,M.M., Lambert,J.C., Harold,D., Schrijvers,E.M., Ramirez-Lorca,R., Debette,S., Longstreth,W.T. Jr., Janssens,A.C., Pankratz,V.S., Dartigues,J.F., Hollingworth,P., Aspelund,T., Hernandez,I., Beiser,A., Kuller,L.H., Koudstaal,P.J., Dickson,D.W., Tzourio,C., Abraham,R., Antunez,C., Du,Y., Rotter,J.I., Aulchenko,Y.S., Harris,T.B., Petersen,R.C., Berr,C., Owen,M.J., Lopez-Arrieta,J., Varadarajan,B.N., Becker,J.T., Rivadeneira,F., Nalls,M.A., Graff-Radford,N.R., Campion,D., Auerbach,S., Rice,K., Hofman,A., Jonsson,P.V., Schmidt,H., Lathrop,M., Mosley,T.H., Au,R., Psaty,B.M., Uitterlinden,A.G., Farrer,L.A., Lumley,T., Ruiz,A., Williams,J., Amouyel,P., Younkin,S.G., Wolf,P.A., Launer,L.J., Lopez,O.L., van Duijn,C.M. and Breteler,M.M.
Journal JAMA 303 (18), 1832-1840 (2010)
Title Genome-wide association studies in an isolated founder population from the Pacific Island of Kosrae .
Author Lowe,J.K., Maller,J.B., Pe'er,I., Neale,B.M., Salit,J., Kenny,E.E., Shea,J.L., Burkhardt,R., Smith,J.G., Ji,W., Noel,M., Foo,J.N., Blundell,M.L., Skilling,V., Garcia,L., Sullivan,M.L., Lee,H.E., Labek,A., Ferdowsian,H., Auerbach,S.B., Lifton,R.P., Newton-Cheh,C., Breslow,J.L., Stoffel,M., Daly,M.J., Altshuler,D.M. and Friedman,J.M.
Journal PLoS Genet. 5 (2), E1000365 (2009)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878