• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens exocyst complex component 3-like 2 (EXOC3L2), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu24148 Homo sapiens exocyst complex component 3-like 2 (EXOC3L2), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu24148C Homo sapiens exocyst complex component 3-like 2 (EXOC3L2), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_138568.3, 226371707
Length 1230 bp
Structure linear
Update Date 11-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens exocyst complex component 3-like 2 (EXOC3L2), mRNA.
Product exocyst complex component 3-like protein 2
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK093466.1, BC104947.1 and AA069926.1. On Apr 4, 2009 this sequence version replaced gi:29788775.


##Evidence-Data-START## Transcript exon combination :: AK093466.1, AK225791.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025083 [ECO:0000348] ##Evidence-Data-END##

RefSeq NP_612635.3
CDS 42..1271
Misc Feature(1)<63..1106
Misc Feature(2)<63..1106
Exon (1)1..19
Gene:EXOC3L2
Gene Synonym:XTP7
Exon (2)20..131
Gene:EXOC3L2
Gene Synonym:XTP7
Exon (3)132..233
Gene:EXOC3L2
Gene Synonym:XTP7
Exon (4)234..334
Gene:EXOC3L2
Gene Synonym:XTP7
Exon (5)335..445
Gene:EXOC3L2
Gene Synonym:XTP7
Exon (6)446..581
Gene:EXOC3L2
Gene Synonym:XTP7
Exon (7)582..704
Gene:EXOC3L2
Gene Synonym:XTP7
Exon (8)705..860
Gene:EXOC3L2
Gene Synonym:XTP7
Exon (9)861..982
Gene:EXOC3L2
Gene Synonym:XTP7
Exon (10)983..1719
Gene:EXOC3L2
Gene Synonym:XTP7
Translation MAALENGELGPLLSPGTLRGLEDECVTDVKAQTRAALLRVLQEDEEHWGSLEDQPSSLAQ DVCELLEEHTERAPRISQEFGERMAHCCLGGLAEFLQSFQQRVERFHENPAVREMLPDTY ISKTIALVNCGPPLRALAERLARVGPPESEPAREASASALDHVTRLCHRVVANLLFQELQ PHFNKLMRRKWLSSPEALDGIVGTLGAQALALRRMQDEPYQALVAELHRRALVEYVRPLL RGRLRCSSARTRSRVAGRLREDAAQLQRLFRRLESQASWLDAVVPHLAEVMQLEDTPSIQ VEVGVLVRDYPDIRQKHVAALLDIRGLRNTAARQEILAVARDLELSEEGALSPPRDRAFF ADIPVPRPSFCLSLPLFLGRLPLSRLARPSLACLPRPRPPSLARPRAQR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(47)-g, adbSNP:138262010
complement(48)-t, cdbSNP:202064916
complement(62)-t, cdbSNP:201110701
complement(96)-g, adbSNP:370356838
complement(141)-dbSNP:
complement(141)-t, gdbSNP:75426681
complement(142)-t, cdbSNP:373136344
complement(153)-g, cdbSNP:377481666
complement(157)-t, cdbSNP:143269965
complement(173)-g, adbSNP:187345620
complement(184)-c, adbSNP:373517053
complement(256)-dbSNP:
complement(256)-t, cdbSNP:143336723
complement(264)-g, adbSNP:73939819
complement(288)-g, adbSNP:138431712
complement(345)-dbSNP:
complement(345)-g, adbSNP:368887693
complement(346)-t, cdbSNP:139655836
complement(350)-t, cdbSNP:140822467
complement(359)-t, gdbSNP:201323099
complement(360)-g, adbSNP:374140555
complement(379)-t, cdbSNP:146408436
complement(400)-t, cdbSNP:144153757
complement(431)-g, adbSNP:140390935
complement(459)-dbSNP:
complement(459)-g, adbSNP:202169742
complement(469)-t, cdbSNP:151207947
complement(481)-g, adbSNP:370054578
complement(488)-g, adbSNP:376475216
complement(494)-t, cdbSNP:10410003
complement(524)-g, adbSNP:148752580
complement(528)-t, cdbSNP:200984629
complement(535)-t, cdbSNP:145255138
complement(547)-t, cdbSNP:145422378
complement(558)-t, cdbSNP:10411314
complement(563)-t, cdbSNP:147446751
complement(603)-dbSNP:
complement(603)-g, adbSNP:143444923
complement(611)-t, cdbSNP:369579237
complement(625)-g, adbSNP:375134450
complement(626)-t, cdbSNP:139986634
complement(652)-g, adbSNP:202199122
complement(820)-dbSNP:
complement(820)-t, cdbSNP:371811745
complement(849)-c, adbSNP:79187950
complement(887)-dbSNP:
complement(887)-g, adbSNP:34958174
complement(965)-g, adbSNP:141938500
complement(973)-g, adbSNP:376151016
complement(1034)-dbSNP:
complement(1034)-g, adbSNP:369915015
complement(1049)-g, adbSNP:148132329
complement(1055)-g, adbSNP:375095520
complement(1056)-t, cdbSNP:372471842
complement(1061)-g, adbSNP:368051115
complement(1068)-g, cdbSNP:201048859
complement(1089)-t, cdbSNP:374946353
complement(1101)-g, cdbSNP:371350226
complement(1111)-t, cdbSNP:367776193
complement(1127)-t, gdbSNP:111862689
complement(1131)-g, cdbSNP:142412403
complement(1180)-t, cdbSNP:373668228
complement(1187)-t, gdbSNP:371153611
complement(1188)-g, cdbSNP:376415591
complement(1209)-t, cdbSNP:181444579
complement(1234)-t, cdbSNP:189063316
complement(1241)-t, cdbSNP:200836902
complement(1250)-t, cdbSNP:201597405
complement(1252)-t, cdbSNP:199587359
complement(1257)-g, adbSNP:199861385
complement(1265)-g, cdbSNP:370326702
complement(1267)-t, cdbSNP:376659728
complement(1274)-t, cdbSNP:377497296
complement(1296)-c, adbSNP:200809286
complement(1315)-t, cdbSNP:185860487
complement(1401)-g, adbSNP:11667430
complement(1406)-g, cdbSNP:11667509
complement(1442)-t, cdbSNP:114087746
complement(1568)-t, cdbSNP:370687272
complement(1602)-t, gdbSNP:143393432
complement(1622)-g, adbSNP:3803906
complement(1653)-t, cdbSNP:369027602
Gene SymbolEXOC3L2
Gene SynonymXTP7
Chromosome19
Locus Map19q13.32
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_138568 Homo sapiens exocyst complex component 3-like 2 (EXOC3L2), mRNA. In-stock $99.00 5-7
Title Association between EXOC3L2 rs597668 polymorphism and Alzheimer's disease .
Author Shang H, Fu J, Zhang XM, Song RR and Wang WZ.
Journal CNS Neurosci Ther 19 (10), 834-839 (2013)
Title Lack of association between rs597668 polymorphism near EXOC3L2 and late-onset Alzheimer's disease in Han Chinese .
Author Liu QY, Miao D, Yu JT, Xing YY, Zhong XL, Wu ZC, Zhang Q and Tan L.
Journal Neurosci. Lett. 513 (2), 174-177 (2012)
Title New gene functions in megakaryopoiesis and platelet formation .
Author Gieger C, Radhakrishnan A, Cvejic A, Tang W, Porcu E, Pistis G, Serbanovic-Canic J, Elling U, Goodall AH, Labrune Y, Lopez LM, Magi R, Meacham S, Okada Y, Pirastu N, Sorice R, Teumer A, Voss K, Zhang W, Ramirez-Solis R, Bis JC, Ellinghaus D, Gogele M, Hottenga JJ, Langenberg C, Kovacs P, O'Reilly PF, Shin SY, Esko T, Hartiala J, Kanoni S, Murgia F, Parsa A, Stephens J, van der Harst P, Ellen van der Schoot C, Allayee H, Attwood A, Balkau B, Bastardot F, Basu S, Baumeister SE, Biino G, Bomba L, Bonnefond A, Cambien F, Chambers JC, Cucca F, D'Adamo P, Davies G, de Boer RA, de Geus EJ, Doring A, Elliott P, Erdmann J, Evans DM, Falchi M, Feng W, Folsom AR, Frazer IH, Gibson QD, Glazer NL, Hammond C, Hartikainen AL, Heckbert SR, Hengstenberg C, Hersch M, Illig T, Loos RJ, Jolley J, Khaw KT, Kuhnel B, Kyrtsonis MC, Lagou V, Lloyd-Jones H, Lumley T, Mangino M, Maschio A, Mateo Leach I, McKnight B, Memari Y, Mitchell BD, Montgomery GW, Nakamura Y, Nauck M, Navis G, Nothlings U, Nolte IM, Porteous DJ, Pouta A, Pramstaller PP, Pullat J, Ring SM, Rotter JI, Ruggiero D, Ruokonen A, Sala C, Samani NJ, Sambrook J, Schlessinger D, Schreiber S, Schunkert H, Scott J, Smith NL, Snieder H, Starr JM, Stumvoll M, Takahashi A, Tang WH, Taylor K, Tenesa A, Lay Thein S, Tonjes A, Uda M, Ulivi S, van Veldhuisen DJ, Visscher PM, Volker U, Wichmann HE, Wiggins KL, Willemsen G, Yang TP, Hua Zhao J, Zitting P, Bradley JR, Dedoussis GV, Gasparini P, Hazen SL, Metspalu A, Pirastu M, Shuldiner AR, Joost van Pelt L, Zwaginga JJ, Boomsma DI, Deary IJ, Franke A, Froguel P, Ganesh SK, Jarvelin MR, Martin NG, Meisinger C, Psaty BM, Spector TD, Wareham NJ, Akkerman JW, Ciullo M, Deloukas P, Greinacher A, Jupe S, Kamatani N, Khadake J, Kooner JS, Penninger J, Prokopenko I, Stemple D, Toniolo D, Wernisch L, Sanna S, Hicks AA, Rendon A, Ferreira MA, Ouwehand WH and Soranzo N.
Journal Nature 480 (7376), 201-208 (2011)
Title Exocyst complex component 3-like 2 (EXOC3L2) associates with the exocyst complex and mediates directional migration of endothelial cells .
Author Barkefors I, Fuchs PF, Heldin J, Bergstrom T, Forsberg-Nilsson K and Kreuger J.
Journal J. Biol. Chem. 286 (27), 24189-24199 (2011)
Title Genome-wide analysis of genetic loci associated with Alzheimer disease .
Author Seshadri S, Fitzpatrick AL, Ikram MA, DeStefano AL, Gudnason V, Boada M, Bis JC, Smith AV, Carassquillo MM, Lambert JC, Harold D, Schrijvers EM, Ramirez-Lorca R, Debette S, Longstreth WT Jr, Janssens AC, Pankratz VS, Dartigues JF, Hollingworth P, Aspelund T, Hernandez I, Beiser A, Kuller LH, Koudstaal PJ, Dickson DW, Tzourio C, Abraham R, Antunez C, Du Y, Rotter JI, Aulchenko YS, Harris TB, Petersen RC, Berr C, Owen MJ, Lopez-Arrieta J, Varadarajan BN, Becker JT, Rivadeneira F, Nalls MA, Graff-Radford NR, Campion D, Auerbach S, Rice K, Hofman A, Jonsson PV, Schmidt H, Lathrop M, Mosley TH, Au R, Psaty BM, Uitterlinden AG, Farrer LA, Lumley T, Ruiz A, Williams J, Amouyel P, Younkin SG, Wolf PA, Launer LJ, Lopez OL, van Duijn CM and Breteler MM.
Journal JAMA 303 (18), 1832-1840 (2010)
Title Genome-wide association studies in an isolated founder population from the Pacific Island of Kosrae .
Author Lowe JK, Maller JB, Pe'er I, Neale BM, Salit J, Kenny EE, Shea JL, Burkhardt R, Smith JG, Ji W, Noel M, Foo JN, Blundell ML, Skilling V, Garcia L, Sullivan ML, Lee HE, Labek A, Ferdowsian H, Auerbach SB, Lifton RP, Newton-Cheh C, Breslow JL, Stoffel M, Daly MJ, Altshuler DM and Friedman JM.
Journal PLoS Genet. 5 (2), E1000365 (2009)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.