• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tetraspanin 32 (TSPAN32), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu08930 Homo sapiens tetraspanin 32 (TSPAN32), mRNA. pcDNA3.1+-DYK On-demand $159.00 7-9
OHu08930C Homo sapiens tetraspanin 32 (TSPAN32), mRNA. Customized vector On-demand $209.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_139022.2, 37595531
Length 963 bp
Structure linear
Update Date 02-MAR-2014
Organism Homo sapiens (human)
Definition Homo sapiens tetraspanin 32 (TSPAN32), mRNA.
Product tetraspanin-32
Comment

Summary: This gene, which is a member of the tetraspanin superfamily, is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of chromosome 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian and breast cancers. This gene is located among several imprinted genes; however, this gene, as well as the tumor-suppressing subchromosomal transferable fragment 4, escapes imprinting. This gene may play a role in malignancies and diseases that involve this region, and it is also involved in hematopoietic cell function. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008].


Sequence Note: A downstream start codon is selected for this RefSeq based on better conservation with homologs. The use of an alternative upstream start codon, which is present in primate species, would increase the protein length from 320 aa to 355 aa. The presence of a predicted signal anchor for the shorter, but not the longer, protein suggests that the downstream start codon may be preferentially used. The shorter protein is described in PMID 11718897.


##Evidence-Data-START## Transcript exon combination :: AY039001.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025082, ERS025083 [ECO:0000350] ##Evidence-Data-END##


##RefSeq-Attributes-START## CDS uses downstream in-frame AUG :: lack of evidence for use of upstream AUG ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_620591.3
CDS 138..1100
Misc Feature(1)33..35
Misc Feature(2)168..806
Misc Feature(3)168..806
Misc Feature(4)177..239
Misc Feature(5)315..377
Misc Feature(6)405..467
Misc Feature(7)474..722
Misc Feature(8)order(477..479,492..494,504..506,510..515,522..524,
Misc Feature(9)744..806
Exon (1)1..203
Gene:TSPAN32
Gene Synonym:ART1; PHEMX; PHMX; TSSC6
Exon (2)204..318
Gene:TSPAN32
Gene Synonym:ART1; PHEMX; PHMX; TSSC6
Exon (3)319..416
Gene:TSPAN32
Gene Synonym:ART1; PHEMX; PHMX; TSSC6
Exon (4)417..491
Gene:TSPAN32
Gene Synonym:ART1; PHEMX; PHMX; TSSC6
Exon (5)492..593
Gene:TSPAN32
Gene Synonym:ART1; PHEMX; PHMX; TSSC6
Exon (6)594..680
Gene:TSPAN32
Gene Synonym:ART1; PHEMX; PHMX; TSSC6
Exon (7)681..764
Gene:TSPAN32
Gene Synonym:ART1; PHEMX; PHMX; TSSC6
Exon (8)765..856
Gene:TSPAN32
Gene Synonym:ART1; PHEMX; PHMX; TSSC6
Exon (9)857..1038
Gene:TSPAN32
Gene Synonym:ART1; PHEMX; PHMX; TSSC6
Exon (10)1039..1376
Gene:TSPAN32
Gene Synonym:ART1; PHEMX; PHMX; TSSC6
Translation MGPWSRVRVAKCQMLVTCFFILLLGLSVATMVTLTYFGAHFAVIRRASLEKNPYQAVHQW AFSAGLSLVGLLTLGAVLSAAATVREAQGLMAGGFLCFSLAFCAQVQVVFWRLHSPTQVE DAMLDTYDLVYEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR EDCLQGIRSFLRTHQQVASSLTSIGLALTVSALLFSSFLWFAIRCGCSLDRKGKYTLTPR ACGRQPQEPSLLRCSQGGPTHCLHSEAVAIGPRGCSGSLRWLQESDAAPLPLSCHLAAHR ALQGRSRGGLSGCPERGLSD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
4+dbSNP:
4+a, gdbSNP:371953629
49+g, tdbSNP:375443053
62+c, tdbSNP:78465685
78+a, cdbSNP:372594309
107+a, gdbSNP:375516709
144+a, cdbSNP:149680436
153+c, tdbSNP:145517785
154+a, gdbSNP:148861275
176+c, gdbSNP:142403358
204+dbSNP:
204+a, cdbSNP:200210112
248+c, tdbSNP:146480945
253+c, tdbSNP:369696526
270+a, cdbSNP:140709712
271+a, gdbSNP:201106606
274+g, tdbSNP:371441475
278+a, gdbSNP:368347803
295+c, tdbSNP:377338457
303+c, gdbSNP:145905096
313+a, cdbSNP:181067559
329+dbSNP:
329+a, gdbSNP:201530910
340+c, tdbSNP:376702018
352+c, tdbSNP:138170136
359+a, gdbSNP:371071821
360+a, gdbSNP:200631781
366+a, gdbSNP:2234296
374+c, tdbSNP:199650987
375+a, gdbSNP:201634419
396+g, tdbSNP:200624662
409+c, tdbSNP:61744929
435+dbSNP:
435+a, cdbSNP:372246596
446+a, c, g, tdbSNP:11554947
486+a, gdbSNP:376562078
497+dbSNP:
497+a, gdbSNP:367966944
500+c, tdbSNP:2234300
501+a, gdbSNP:2234301
518+c, tdbSNP:147630481
547+g, tdbSNP:112455917
557+c, tdbSNP:368872715
561+c, tdbSNP:374473348
562+a, gdbSNP:138129469
565+a, gdbSNP:2234302
618+dbSNP:
618+a, cdbSNP:147219779
627+c, tdbSNP:148601311
628+a, gdbSNP:142056890
674+a, gdbSNP:200478299
699+dbSNP:
699+c, tdbSNP:376763237
701+a, gdbSNP:186572696
725+g, tdbSNP:369033190
728+c, tdbSNP:150731413
729+a, gdbSNP:371671456
756+g, tdbSNP:201400387
779+dbSNP:
779+c, gdbSNP:200678268
805+c, tdbSNP:374327578
807+c, tdbSNP:200026082
815+c, tdbSNP:369812524
817+a, gdbSNP:143112175
852+c, tdbSNP:377055075
856+a, gdbSNP:371452736
867+dbSNP:
867+c, tdbSNP:375291522
898+g, tdbSNP:3180160
904+a, tdbSNP:139081815
916+c, tdbSNP:144063439
922+a, gdbSNP:146837754
932+c, tdbSNP:140677453
954+a, gdbSNP:144460879
955+c, gdbSNP:367851224
960+c, tdbSNP:34745234
964+c, tdbSNP:149230396
965+c, gdbSNP:371556972
975+c, tdbSNP:143225348
976+a, gdbSNP:375834458
985+a, gdbSNP:113472219
988+a, tdbSNP:201780596
992+c, tdbSNP:191438651
993+a, gdbSNP:200106123
1009+a, cdbSNP:151256721
1013+c, tdbSNP:200348092
1057+dbSNP:
1057+a, g, tdbSNP:140477675
1083+c, tdbSNP:147063227
1084+a, gdbSNP:199740795
1089+c, tdbSNP:369421182
1102+a, gdbSNP:372687754
1118+c, tdbSNP:376926277
1141+a, gdbSNP:2234316
complement(1211)-t, adbSNP:2651818
1362+c, tdbSNP:188723879
Gene SymbolTSPAN32
Gene SynonymART1; PHEMX; PHMX; TSSC6
Chromosome11
Locus Map11p15.5
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_139022 Homo sapiens tetraspanin 32 (TSPAN32), mRNA. On-demand $159.00 7-9
NM_139022 Homo sapiens tetraspanin 32 (TSPAN32), mRNA. On-demand $159.00 7-9
NM_139022 Homo sapiens tetraspanin 32 (TSPAN32), mRNA. On-demand $159.00 7-9
NM_139022 Homo sapiens tetraspanin 32 (TSPAN32), mRNA. On-demand $159.00 7-9
Title Genome-wide association study identifies multiple risk loci for chronic lymphocytic leukemia .
Author Berndt SI, Skibola CF, Joseph V, Camp NJ, Nieters A, Wang Z, Cozen W, Monnereau A, Wang SS, Kelly RS, Lan Q, Teras LR, Chatterjee N, Chung CC, Yeager M, Brooks-Wilson AR, Hartge P, Purdue MP, Birmann BM, Armstrong BK, Cocco P, Zhang Y, Severi G, Zeleniuch-Jacquotte A, Lawrence C, Burdette L, Yuenger J, Hutchinson A, Jacobs KB, Call TG, Shanafelt TD, Novak AJ, Kay NE, Liebow M, Wang AH, Smedby KE, Adami HO, Melbye M, Glimelius B, Chang ET, Glenn M, Curtin K, Cannon-Albright LA, Jones B, Diver WR, Link BK, Weiner GJ, Conde L, Bracci PM, Riby J, Holly EA, Smith MT, Jackson RD, Tinker LF, Benavente Y, Becker N, Boffetta P, Brennan P, Foretova L, Maynadie M, McKay J, Staines A, Rabe KG, Achenbach SJ, Vachon CM, Goldin LR, Strom SS, Lanasa MC, Spector LG, Leis JF, Cunningham JM, Weinberg JB, Morrison VA, Caporaso NE, Norman AD, Linet MS, De Roos AJ, Morton LM, Severson RK, Riboli E, Vineis P, Kaaks R, Trichopoulos D, Masala G, Weiderpass E, Chirlaque MD, Vermeulen RC, Travis RC, Giles GG, Albanes D, Virtamo J, Weinstein S, Clavel J, Zheng T, Holford TR, Offit K, Zelenetz A, Klein RJ, Spinelli JJ, Bertrand KA, Laden F, Giovannucci E, Kraft P, Kricker A, Turner J, Vajdic CM, Ennas MG, Ferri GM, Miligi L, Liang L, Sampson J, Crouch S, Park JH, North KE, Cox A, Snowden JA, Wright J, Carracedo A, Lopez-Otin C, Bea S, Salaverria I, Martin-Garcia D, Campo E, Fraumeni JF Jr, de Sanjose S, Hjalgrim H, Cerhan JR, Chanock SJ, Rothman N and Slager SL.
Journal Nat. Genet. 45 (8), 868-876 (2013)
Title A complementary role for the tetraspanins CD37 and Tssc6 in cellular immunity .
Author Gartlan KH, Belz GT, Tarrant JM, Minigo G, Katsara M, Sheng KC, Sofi M, van Spriel AB, Apostolopoulos V, Plebanski M, Robb L and Wright MD.
Journal J. Immunol. 185 (6), 3158-3166 (2010)
Title Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins .
Author Macaulay IC, Tijssen MR, Thijssen-Timmer DC, Gusnanto A, Steward M, Burns P, Langford CF, Ellis PD, Dudbridge F, Zwaginga JJ, Watkins NA, van der Schoot CE and Ouwehand WH.
Journal Blood 109 (8), 3260-3269 (2007)
Title Molecular characterisation of mouse and human TSSC6: evidence that TSSC6 is a genuine member of the tetraspanin superfamily and is expressed specifically in haematopoietic organs .
Author Robb L, Tarrant J, Groom J, Ibrahim M, Li R, Borobakas B and Wright MD.
Journal Biochim. Biophys. Acta 1522 (1), 31-41 (2001)
Title Phemx, a novel mouse gene expressed in hematopoietic cells maps to the imprinted cluster on distal chromosome 7 .
Author Nicholson RH, Pantano S, Eliason JF, Galy A, Weiler S, Kaplan J, Hughes MR and Ko MS.
Journal Genomics 68 (1), 13-21 (2000)
Title Sequence conservation and variability of imprinting in the Beckwith-Wiedemann syndrome gene cluster in human and mouse .
Author Paulsen M, El-Maarri O, Engemann S, Strodicke M, Franck O, Davies K, Reinhardt R, Reik W and Walter J.
Journal Hum. Mol. Genet. 9 (12), 1829-1841 (2000)
Title Two novel genes in the center of the 11p15 imprinted domain escape genomic imprinting .
Author Lee MP, Brandenburg S, Landes GM, Adams M, Miller G and Feinberg AP.
Journal Hum. Mol. Genet. 8 (4), 683-690 (1999)
Title A 2.5-Mb transcript map of a tumor-suppressing subchromosomal transferable fragment from 11p15.5, and isolation and sequence analysis of three novel genes .
Author Hu RJ, Lee MP, Connors TD, Johnson LA, Burn TC, Su K, Landes GM and Feinberg AP.
Journal Genomics 46 (1), 9-17 (1997)
Title Tumor cell growth arrest caused by subchromosomal transferable DNA fragments from chromosome 11 .
Author Koi M, Johnson LA, Kalikin LM, Little PF, Nakamura Y and Feinberg AP.
Journal Science 260 (5106), 361-364 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.