• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tetraspanin 32 (TSPAN32), mRNA.


RefSeq Accession Definition Services Price Order
NM_139022 Homo sapiens tetraspanin 32 (TSPAN32), mRNA. ORF Sequence $279.27
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_139022.2, 37595531
Length 1376 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens tetraspanin 32 (TSPAN32), mRNA.
Product tetraspanin-32
Comment

Summary: This gene, which is a member of the tetraspanin superfamily, is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of chromosome 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian and breast cancers. This gene is located among several imprinted genes; however, this gene, as well as the tumor-suppressing subchromosomal transferable fragment 4, escapes imprinting. This gene may play a role in malignancies and diseases that involve this region, and it is also involved in hematopoietic cell function. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008].


Sequence Note: A downstream start codon is selected for this RefSeq based on better conservation with homologs. The use of an alternative upstream start codon, which is present in primate species, would increase the protein length from 320 aa to 355 aa. The presence of a predicted signal anchor for the shorter, but not the longer, protein suggests that the downstream start codon may be preferentially used. The shorter protein is described in PMID 11718897.


##Evidence-Data-START## Transcript exon combination :: AY039001.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_620591.3
CDS 138..1100
Misc Feature(1)33..35
Misc Feature(2)33..35
Misc Feature(3)168..806
Misc Feature(4)168..806
Misc Feature(5)177..239
Misc Feature(6)315..377
Misc Feature(7)405..467
Misc Feature(8)474..722
Misc Feature(9)order(477..479,492..494,504..506,510..515,522..524,
Misc Feature(10)744..806
Exon (1)1..203
Gene:TSPAN32
Gene Synonym:ART1; PHEMX; PHMX; TSSC6
Exon (2)204..318
Gene:TSPAN32
Gene Synonym:ART1; PHEMX; PHMX; TSSC6
Exon (3)319..416
Gene:TSPAN32
Gene Synonym:ART1; PHEMX; PHMX; TSSC6
Exon (4)417..491
Gene:TSPAN32
Gene Synonym:ART1; PHEMX; PHMX; TSSC6
Exon (5)492..593
Gene:TSPAN32
Gene Synonym:ART1; PHEMX; PHMX; TSSC6
Exon (6)594..680
Gene:TSPAN32
Gene Synonym:ART1; PHEMX; PHMX; TSSC6
Exon (7)681..764
Gene:TSPAN32
Gene Synonym:ART1; PHEMX; PHMX; TSSC6
Exon (8)765..856
Gene:TSPAN32
Gene Synonym:ART1; PHEMX; PHMX; TSSC6
Exon (9)857..1038
Gene:TSPAN32
Gene Synonym:ART1; PHEMX; PHMX; TSSC6
Exon (10)1039..1376
Gene:TSPAN32
Gene Synonym:ART1; PHEMX; PHMX; TSSC6
Translation MGPWSRVRVAKCQMLVTCFFILLLGLSVATMVTLTYFGAHFAVIRRASLEKNPYQAVHQW AFSAGLSLVGLLTLGAVLSAAATVREAQGLMAGGFLCFSLAFCAQVQVVFWRLHSPTQVE DAMLDTYDLVYEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR EDCLQGIRSFLRTHQQVASSLTSIGLALTVSALLFSSFLWFAIRCGCSLDRKGKYTLTPR ACGRQPQEPSLLRCSQGGPTHCLHSEAVAIGPRGCSGSLRWLQESDAAPLPLSCHLAAHR ALQGRSRGGLSGCPERGLSD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
62+c, tdbSNP:78465685
144+a, cdbSNP:149680436
153+c, tdbSNP:145517785
154+a, gdbSNP:148861275
176+c, gdbSNP:142403358
204+dbSNP:
204+a, cdbSNP:200210112
248+c, tdbSNP:146480945
270+a, cdbSNP:140709712
271+a, gdbSNP:201106606
303+c, gdbSNP:145905096
313+a, cdbSNP:181067559
329+dbSNP:
329+a, gdbSNP:201530910
352+c, tdbSNP:138170136
360+a, gdbSNP:200631781
366+a, gdbSNP:2234296
374+c, tdbSNP:199650987
375+a, gdbSNP:201634419
396+g, tdbSNP:200624662
409+c, tdbSNP:61744929
446+dbSNP:
446+a, c, g, tdbSNP:11554947
500+dbSNP:
500+c, tdbSNP:2234300
501+a, gdbSNP:2234301
518+c, tdbSNP:147630481
547+g, tdbSNP:112455917
562+a, gdbSNP:138129469
565+a, gdbSNP:2234302
618+dbSNP:
618+a, cdbSNP:147219779
627+c, tdbSNP:148601311
628+a, gdbSNP:142056890
674+a, gdbSNP:200478299
701+dbSNP:
701+a, gdbSNP:186572696
728+c, tdbSNP:150731413
756+g, tdbSNP:201400387
779+dbSNP:
779+c, gdbSNP:200678268
807+c, tdbSNP:200026082
817+a, gdbSNP:143112175
898+dbSNP:
898+g, tdbSNP:3180160
904+a, tdbSNP:139081815
916+c, tdbSNP:144063439
922+a, gdbSNP:146837754
932+c, tdbSNP:140677453
954+a, gdbSNP:144460879
960+c, tdbSNP:34745234
964+c, tdbSNP:149230396
975+c, tdbSNP:143225348
985+a, gdbSNP:113472219
988+a, tdbSNP:201780596
992+c, tdbSNP:191438651
993+a, gdbSNP:200106123
1009+a, cdbSNP:151256721
1013+c, tdbSNP:200348092
1057+dbSNP:
1057+a, g, tdbSNP:140477675
1083+c, tdbSNP:147063227
1084+a, gdbSNP:199740795
1141+a, gdbSNP:2234316
1211+a, tdbSNP:2651818
1362+c, tdbSNP:188723879
Gene SymbolTSPAN32
Gene SynonymART1; PHEMX; PHMX; TSSC6
Chromosome11
Locus Map11p15.5
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_139022 Homo sapiens tetraspanin 32 (TSPAN32), mRNA. Full Length $399.04
ORF Sequence $279.27
Title A complementary role for the tetraspanins CD37 and Tssc6 in cellular immunity .
Author Gartlan,K.H., Belz,G.T., Tarrant,J.M., Minigo,G., Katsara,M., Sheng,K.C., Sofi,M., van Spriel,A.B., Apostolopoulos,V., Plebanski,M., Robb,L. and Wright,M.D.
Journal J. Immunol. 185 (6), 3158-3166 (2010)
Title Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins .
Author Macaulay,I.C., Tijssen,M.R., Thijssen-Timmer,D.C., Gusnanto,A., Steward,M., Burns,P., Langford,C.F., Ellis,P.D., Dudbridge,F., Zwaginga,J.J., Watkins,N.A., van der Schoot,C.E. and Ouwehand,W.H.
Journal Blood 109 (8), 3260-3269 (2007)
Title Molecular characterisation of mouse and human TSSC6: evidence that TSSC6 is a genuine member of the tetraspanin superfamily and is expressed specifically in haematopoietic organs .
Author Robb,L., Tarrant,J., Groom,J., Ibrahim,M., Li,R., Borobakas,B. and Wright,M.D.
Journal Biochim. Biophys. Acta 1522 (1), 31-41 (2001)
Title Phemx, a novel mouse gene expressed in hematopoietic cells maps to the imprinted cluster on distal chromosome 7 .
Author Nicholson,R.H., Pantano,S., Eliason,J.F., Galy,A., Weiler,S., Kaplan,J., Hughes,M.R. and Ko,M.S.
Journal Genomics 68 (1), 13-21 (2000)
Title Sequence conservation and variability of imprinting in the Beckwith-Wiedemann syndrome gene cluster in human and mouse .
Author Paulsen,M., El-Maarri,O., Engemann,S., Strodicke,M., Franck,O., Davies,K., Reinhardt,R., Reik,W. and Walter,J.
Journal Hum. Mol. Genet. 9 (12), 1829-1841 (2000)
Title Two novel genes in the center of the 11p15 imprinted domain escape genomic imprinting .
Author Lee,M.P., Brandenburg,S., Landes,G.M., Adams,M., Miller,G. and Feinberg,A.P.
Journal Hum. Mol. Genet. 8 (4), 683-690 (1999)
Title A 2.5-Mb transcript map of a tumor-suppressing subchromosomal transferable fragment from 11p15.5, and isolation and sequence analysis of three novel genes .
Author Hu,R.J., Lee,M.P., Connors,T.D., Johnson,L.A., Burn,T.C., Su,K., Landes,G.M. and Feinberg,A.P.
Journal Genomics 46 (1), 9-17 (1997)
Title Tumor cell growth arrest caused by subchromosomal transferable DNA fragments from chromosome 11 .
Author Koi,M., Johnson,L.A., Kalikin,L.M., Little,P.F., Nakamura,Y. and Feinberg,A.P.
Journal Science 260 (5106), 361-364 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878