Sequence in raw or FASTA format:
Homo sapiens tetraspanin 32 (TSPAN32), mRNA.
| RefSeq Version | NM_139022.2, 37595531 |
| Length | 1376 bp |
| Structure | linear |
| Update Date | 12-MAR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens tetraspanin 32 (TSPAN32), mRNA. |
| Product | tetraspanin-32 |
| Comment | Summary: This gene, which is a member of the tetraspanin superfamily, is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of chromosome 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian and breast cancers. This gene is located among several imprinted genes; however, this gene, as well as the tumor-suppressing subchromosomal transferable fragment 4, escapes imprinting. This gene may play a role in malignancies and diseases that involve this region, and it is also involved in hematopoietic cell function. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq]. Sequence Note: A downstream start codon is selected for this RefSeq based on better conservation with homologs. The use of an alternative upstream start codon, which is present in primate species, would increase the protein length from 320 aa to 355 aa. The presence of a predicted signal anchor for the shorter, but not the longer, protein suggests that the downstream start codon may be preferentially used. The shorter protein is described in PMID 11718897. COMPLETENESS: complete on the 3' end. |
| RefSeq | NP_620591.3 |
| CDS | 138..1100 | Exon (1) | 1..203 | Exon (2) | 1..203 | Exon (3) | 204..318 | Exon (4) | 319..416 | Exon (5) | 417..491 | Exon (6) | 492..593 | Exon (7) | 594..680 | Exon (8) | 681..764 | Exon (9) | 765..856 | Exon (10) | 857..1038 | Exon (11) | 1039..1376 |
| Translation | MGPWSRVRVAKCQMLVTCFFILLLGLSVATMVTLTYFGAHFAVIRRASLEKNPYQAVHQW
AFSAGLSLVGLLTLGAVLSAAATVREAQGLMAGGFLCFSLAFCAQVQVVFWRLHSPTQVE
DAMLDTYDLVYEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR
EDCLQGIRSFLRTHQQVASSLTSIGLALTVSALLFSSFLWFAIRCGCSLDRKGKYTLTPR
ACGRQPQEPSLLRCSQGGPTHCLHSEAVAIGPRGCSGSLRWLQESDAAPLPLSCHLAAHR
ALQGRSRGGLSGCPERGLSD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| 62 | + | c, t | dbSNP:78465685 |
| 366 | + | a, g | dbSNP:2234296 |
| 409 | + | c, t | dbSNP:61744929 |
| 446 | + | c, t | dbSNP:11554947 |
| 500 | + | c, t | dbSNP:2234300 |
| 501 | + | a, g | dbSNP:2234301 |
| 547 | + | g, t | dbSNP:112455917 |
| 565 | + | a, g | dbSNP:2234302 |
| 898 | + | g, t | dbSNP:3180160 |
| 960 | + | c, t | dbSNP:34745234 |
| 985 | + | a, g | dbSNP:113472219 |
| 1141 | + | a, g | dbSNP:2234316 |
| complement(1211) | - | t, a | dbSNP:2651818 |
| 1362 | + | c, t | dbSNP:117510290 |
| Gene Symbol | TSPAN32 |
| Gene Synonym | ART1; FLJ17158; FLJ97586; MGC22455; PHEMX; PHMX; TSSC6 |
| Chromosome | 11 |
| Locus Map | 11p15.5 |
| All Transcripts | NM_139022 |
| Title | A complementary role for the tetraspanins CD37 and Tssc6 in cellular immunity . |
| Author | Gartlan,K.H., Belz,G.T., Tarrant,J.M., Minigo,G., Katsara,M., Sheng,K.C., Sofi,M., van Spriel,A.B., Apostolopoulos,V., Plebanski,M., Robb,L. and Wright,M.D. |
| Journal | J. Immunol. 185 (6), 3158-3166 (2010) |
| Title | Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins . |
| Author | Macaulay,I.C., Tijssen,M.R., Thijssen-Timmer,D.C., Gusnanto,A., Steward,M., Burns,P., Langford,C.F., Ellis,P.D., Dudbridge,F., Zwaginga,J.J., Watkins,N.A., van der Schoot,C.E. and Ouwehand,W.H. |
| Journal | Blood 109 (8), 3260-3269 (2007) |
| Title | Molecular characterisation of mouse and human TSSC6: evidence that TSSC6 is a genuine member of the tetraspanin superfamily and is expressed specifically in haematopoietic organs . |
| Author | Robb,L., Tarrant,J., Groom,J., Ibrahim,M., Li,R., Borobakas,B. and Wright,M.D. |
| Journal | Biochim. Biophys. Acta 1522 (1), 31-41 (2001) |
| Title | Phemx, a novel mouse gene expressed in hematopoietic cells maps to the imprinted cluster on distal chromosome 7 . |
| Author | Nicholson,R.H., Pantano,S., Eliason,J.F., Galy,A., Weiler,S., Kaplan,J., Hughes,M.R. and Ko,M.S. |
| Journal | Genomics 68 (1), 13-21 (2000) |
| Title | Sequence conservation and variability of imprinting in the Beckwith-Wiedemann syndrome gene cluster in human and mouse . |
| Author | Paulsen,M., El-Maarri,O., Engemann,S., Strodicke,M., Franck,O., Davies,K., Reinhardt,R., Reik,W. and Walter,J. |
| Journal | Hum. Mol. Genet. 9 (12), 1829-1841 (2000) |
| Title | Two novel genes in the center of the 11p15 imprinted domain escape genomic imprinting . |
| Author | Lee,M.P., Brandenburg,S., Landes,G.M., Adams,M., Miller,G. and Feinberg,A.P. |
| Journal | Hum. Mol. Genet. 8 (4), 683-690 (1999) |
| Title | A 2.5-Mb transcript map of a tumor-suppressing subchromosomal transferable fragment from 11p15.5, and isolation and sequence analysis of three novel genes . |
| Author | Hu,R.J., Lee,M.P., Connors,T.D., Johnson,L.A., Burn,T.C., Su,K., Landes,G.M. and Feinberg,A.P. |
| Journal | Genomics 46 (1), 9-17 (1997) |
| Title | Tumor cell growth arrest caused by subchromosomal transferable DNA fragments from chromosome 11 . |
| Author | Koi,M., Johnson,L.A., Kalikin,L.M., Little,P.F., Nakamura,Y. and Feinberg,A.P. |
| Journal | Science 260 (5106), 361-364 (1993) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |