• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ADAM metallopeptidase with thrombospondin type 1 motif, 13 (ADAMTS13), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_139025 Homo sapiens ADAM metallopeptidase with thrombospondin type 1 motif, 13 (ADAMTS13), transcript variant 1, mRNA. ORF Sequence $1499.40
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_139025.3, 190881474
Length 4941 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens ADAM metallopeptidase with thrombospondin type 1 motif, 13 (ADAMTS13), transcript variant 1, mRNA.
Product A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform 1 preproprotein
Comment

Summary: This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme encoded by this gene is the von Willebrand Factor (vWF)-cleaving protease, which is responsible for cleaving at the site of Tyr842-Met843 of the vWF molecule. A deficiency of this enzyme is associated with thrombotic thrombocytopenic purpura. Alternative splicing of this gene generates multiple transcript variants encoding different isoforms. [provided by RefSeq, Nov 2008].


Transcript Variant: This variant (1) encodes the longest isoform (1).

RefSeq NP_620594.1
CDS 445..4728
Misc Feature(1)352..354
Misc Feature(2)682..1293
Misc Feature(3)order(1114..1119,1126..1128,1144..1146)
Misc Feature(4)1342..1566
Misc Feature(5)1603..1761
Misc Feature(6)1936..1944
Misc Feature(7)2110..2499
Exon (1)1..549
Gene:ADAMTS13
Gene Synonym:13; ADAM-TS; ADAM-TS13; ADAMTS-13; C9orf8; TTP; vWF-CP; VWFCP
Exon (2)550..616
Gene:ADAMTS13
Gene Synonym:13; ADAM-TS; ADAM-TS13; ADAMTS-13; C9orf8; TTP; vWF-CP; VWFCP
Exon (3)617..774
Gene:ADAMTS13
Gene Synonym:13; ADAM-TS; ADAM-TS13; ADAMTS-13; C9orf8; TTP; vWF-CP; VWFCP
Exon (4)775..858
Gene:ADAMTS13
Gene Synonym:13; ADAM-TS; ADAM-TS13; ADAMTS-13; C9orf8; TTP; vWF-CP; VWFCP
Exon (5)859..983
Gene:ADAMTS13
Gene Synonym:13; ADAM-TS; ADAM-TS13; ADAMTS-13; C9orf8; TTP; vWF-CP; VWFCP
Exon (6)984..1130
Gene:ADAMTS13
Gene Synonym:13; ADAM-TS; ADAM-TS13; ADAMTS-13; C9orf8; TTP; vWF-CP; VWFCP
Exon (7)1131..1268
Gene:ADAMTS13
Gene Synonym:13; ADAM-TS; ADAM-TS13; ADAMTS-13; C9orf8; TTP; vWF-CP; VWFCP
Exon (8)1269..1431
Gene:ADAMTS13
Gene Synonym:13; ADAM-TS; ADAM-TS13; ADAMTS-13; C9orf8; TTP; vWF-CP; VWFCP
Exon (9)1432..1536
Gene:ADAMTS13
Gene Synonym:13; ADAM-TS; ADAM-TS13; ADAMTS-13; C9orf8; TTP; vWF-CP; VWFCP
Exon (10)1537..1688
Gene:ADAMTS13
Gene Synonym:13; ADAM-TS; ADAM-TS13; ADAMTS-13; C9orf8; TTP; vWF-CP; VWFCP
Exon (11)1689..1752
Gene:ADAMTS13
Gene Synonym:13; ADAM-TS; ADAM-TS13; ADAMTS-13; C9orf8; TTP; vWF-CP; VWFCP
Exon (12)1753..1879
Gene:ADAMTS13
Gene Synonym:13; ADAM-TS; ADAM-TS13; ADAMTS-13; C9orf8; TTP; vWF-CP; VWFCP
Exon (13)1880..2028
Gene:ADAMTS13
Gene Synonym:13; ADAM-TS; ADAM-TS13; ADAMTS-13; C9orf8; TTP; vWF-CP; VWFCP
Exon (14)2029..2149
Gene:ADAMTS13
Gene Synonym:13; ADAM-TS; ADAM-TS13; ADAMTS-13; C9orf8; TTP; vWF-CP; VWFCP
Exon (15)2150..2230
Gene:ADAMTS13
Gene Synonym:13; ADAM-TS; ADAM-TS13; ADAMTS-13; C9orf8; TTP; vWF-CP; VWFCP
Exon (16)2231..2412
Gene:ADAMTS13
Gene Synonym:13; ADAM-TS; ADAM-TS13; ADAMTS-13; C9orf8; TTP; vWF-CP; VWFCP
Exon (17)2413..2548
Gene:ADAMTS13
Gene Synonym:13; ADAM-TS; ADAM-TS13; ADAMTS-13; C9orf8; TTP; vWF-CP; VWFCP
Exon (18)2549..2678
Gene:ADAMTS13
Gene Synonym:13; ADAM-TS; ADAM-TS13; ADAMTS-13; C9orf8; TTP; vWF-CP; VWFCP
Exon (19)2679..2864
Gene:ADAMTS13
Gene Synonym:13; ADAM-TS; ADAM-TS13; ADAMTS-13; C9orf8; TTP; vWF-CP; VWFCP
Exon (20)2865..3054
Gene:ADAMTS13
Gene Synonym:13; ADAM-TS; ADAM-TS13; ADAMTS-13; C9orf8; TTP; vWF-CP; VWFCP
Exon (21)3055..3175
Gene:ADAMTS13
Gene Synonym:13; ADAM-TS; ADAM-TS13; ADAMTS-13; C9orf8; TTP; vWF-CP; VWFCP
Exon (22)3176..3305
Gene:ADAMTS13
Gene Synonym:13; ADAM-TS; ADAM-TS13; ADAMTS-13; C9orf8; TTP; vWF-CP; VWFCP
Exon (23)3306..3488
Gene:ADAMTS13
Gene Synonym:13; ADAM-TS; ADAM-TS13; ADAMTS-13; C9orf8; TTP; vWF-CP; VWFCP
Exon (24)3489..3693
Gene:ADAMTS13
Gene Synonym:13; ADAM-TS; ADAM-TS13; ADAMTS-13; C9orf8; TTP; vWF-CP; VWFCP
Exon (25)3694..4012
Gene:ADAMTS13
Gene Synonym:13; ADAM-TS; ADAM-TS13; ADAMTS-13; C9orf8; TTP; vWF-CP; VWFCP
Exon (26)4013..4159
Gene:ADAMTS13
Gene Synonym:13; ADAM-TS; ADAM-TS13; ADAMTS-13; C9orf8; TTP; vWF-CP; VWFCP
Exon (27)4160..4336
Gene:ADAMTS13
Gene Synonym:13; ADAM-TS; ADAM-TS13; ADAMTS-13; C9orf8; TTP; vWF-CP; VWFCP
Exon (28)4337..4521
Gene:ADAMTS13
Gene Synonym:13; ADAM-TS; ADAM-TS13; ADAMTS-13; C9orf8; TTP; vWF-CP; VWFCP
Exon (29)4522..4934
Gene:ADAMTS13
Gene Synonym:13; ADAM-TS; ADAM-TS13; ADAMTS-13; C9orf8; TTP; vWF-CP; VWFCP
Translation MHQRHPRARCPPLCVAGILACGFLLGCWGPSHFQQSCLQALEPQAVSSYLSPGAPLKGRP PSPGFQRQRQRQRRAAGGILHLELLVAVGPDVFQAHQEDTERYVLTNLNIGAELLRDPSL GAQFRVHLVKMVILTEPEGAPNITANLTSSLLSVCGWSQTINPEDDTDPGHADLVLYITR FDLELPDGNRQVRGVTQLGGACSPTWSCLITEDTGFDLGVTIAHEIGHSFGLEHDGAPGS GCGPSGHVMASDGAAPRAGLAWSPCSRRQLLSLLSAGRARCVWDPPRPQPGSAGHPPDAQ PGLYYSANEQCRVAFGPKAVACTFAREHLDMCQALSCHTDPLDQSSCSRLLVPLLDGTEC GVEKWCSKGRCRSLVELTPIAAVHGRWSSWGPRSPCSRSCGGGVVTRRRQCNNPRPAFGG RACVGADLQAEMCNTQACEKTQLEFMSQQCARTDGQPLRSSPGGASFYHWGAAVPHSQGD ALCRHMCRAIGESFIMKRGDSFLDGTRCMPSGPREDGTLSLCVSGSCRTFGCDGRMDSQQ VWDRCQVCGGDNSTCSPRKGSFTAGRAREYVTFLTVTPNLTSVYIANHRPLFTHLAVRIG GRYVVAGKMSISPNTTYPSLLEDGRVEYRVALTEDRLPRLEEIRIWGPLQEDADIQVYRR YGEEYGNLTRPDITFTYFQPKPRQAWVWAAVRGPCSVSCGAGLRWVNYSCLDQARKELVE TVQCQGSQQPPAWPEACVLEPCPPYWAVGDFGPCSASCGGGLRERPVRCVEAQGSLLKTL PPARCRAGAQQPAVALETCNPQPCPARWEVSEPSSCTSAGGAGLALENETCVPGADGLEA PVTEGPGSVDEKLPAPEPCVGMSCPPGWGHLDATSAGEKAPSPWGSIRTGAQAAHVWTPA AGSCSVSCGRGLMELRFLCMDSALRVPVQEELCGLASKPGSRREVCQAVPCPARWQYKLA ACSVSCGRGVVRRILYCARAHGEDDGEEILLDTQCQGLPRPEPQEACSLEPCPPRWKVMS LGPCSASCGLGTARRSVACVQLDQGQDVEVDEAACAALVRPEASVPCLIADCTYRWHVGT WMECSVSCGDGIQRRRDTCLGPQAQAPVPADFCQHLPKPVTVRGCWAGPCVGQGTPSLVP HEEAAAPGRTTATPAGASLEWSQARGLLFSPAPQPRRLLPGPQENSVQSSACGRQHLEPT GTIDMRGPGQADCAVAIGRPLGEVVTLRVLESSLNCSAGDMLLLWGRLTWRKMCRKLLDM TFSSKTNTLVVRQRCGRPGGGVLLRYGSQLAPETFYRECDMQLFGPWGEIVSPSLSPATS NAGGCRLFINVAPHARIAIHALATNMGAGTEGANASYILIRDTHSLRTTAFHGQQVLYWE SESSQAEMEFSEGFLKAQASLRGQYWTLQSWVPEMQDPQSWKGKEGT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
88+dbSNP:
88+c, tdbSNP:34265876
275+c, tdbSNP:112367941
277+c, tdbSNP:36218240
414+c, tdbSNP:201526748
459+c, g, tdbSNP:77985067
463+c, tdbSNP:34024143
496+a, gdbSNP:138886920
502+a, gdbSNP:142293909
556+dbSNP:
556+c, tdbSNP:199854018
579+c, tdbSNP:146394542
580+a, gdbSNP:201522226
606+c, tdbSNP:140757999
607+a, gdbSNP:201828143
615+c, tdbSNP:200846181
619+dbSNP:
619+c, tdbSNP:139735640
628+c, tdbSNP:78554244
668+c, gdbSNP:142366230
669+c, tdbSNP:143856697
670+a, gdbSNP:4962048
681+c, gdbSNP:281875297
682+c, tdbSNP:200841843
685+c, tdbSNP:148644959
706+a, gdbSNP:281875302
730+c, gdbSNP:121908467
748+c, tdbSNP:121908469
774+c, tdbSNP:142107133
791+dbSNP:
791+a, gdbSNP:151206890
798+a, gdbSNP:28571612
800+c, tdbSNP:281875291
801+c, tdbSNP:147563206
844+c, gdbSNP:147643918
850+a, gdbSNP:142237685
864+dbSNP:
864+c, tdbSNP:3118667
871+a, gdbSNP:145175796
879+c, tdbSNP:149175416
944+c, tdbSNP:141932927
974+a, gdbSNP:200594025
977+c, tdbSNP:281875289
990+dbSNP:
990+c, tdbSNP:148849381
1003+c, gdbSNP:148312697
1013+a, gdbSNP:142152759
1021+c, tdbSNP:281875287
1026+c, tdbSNP:34054981
1027+a, gdbSNP:138489501
1031+c, tdbSNP:121908470
1041+c, tdbSNP:201048039
1051+c, tdbSNP:281875298
1071+c, gdbSNP:143035878
1074+g, tdbSNP:199661242
1096+c, tdbSNP:200017456
1139+dbSNP:
1139+a, tdbSNP:281875292
1146+a, cdbSNP:281875304
1147+c, gdbSNP:281875337
1193+c, tdbSNP:121908478
1232+c, gdbSNP:281875293
1247+c, gdbSNP:121908477
1355+dbSNP:
1355+a, gdbSNP:281875285
1363+a, gdbSNP:150518374
1376+a, gdbSNP:281875336
1380+c, tdbSNP:36219562
1460+dbSNP:
1460+c, gdbSNP:149517360
1464+c, tdbSNP:144498742
1466+c, tdbSNP:115943536
1467+a, gdbSNP:199953481
1483+a, tdbSNP:281875294
1489+c, tdbSNP:281875288
1502+c, tdbSNP:281875338
1552+dbSNP:
1552+c, tdbSNP:145252342
1553+a, gdbSNP:200406381
1581+c, tdbSNP:147607799
1596+c, tdbSNP:140640175
1600+a, c, tdbSNP:142214608
1601+a, gdbSNP:151048660
1614+c, gdbSNP:281875306
1622+a, gdbSNP:140937290
1637+a, gdbSNP:121908471
1644+c, tdbSNP:142570561
1659+c, tdbSNP:145768029
1676+a, gdbSNP:140582930
1705+dbSNP:
1705+c, tdbSNP:145825553
1734+c, tdbSNP:138401488
1740+a, gdbSNP:141471395
1786+dbSNP:
1786+c, gdbSNP:2301612
1789+c, tdbSNP:121908476
1803+c, tdbSNP:148365271
1812+g, tdbSNP:36220239
1814+c, tdbSNP:36220240
1833+c, tdbSNP:138035204
1867+c, tdbSNP:11575933
1895+dbSNP:
1895+a, gdbSNP:28375042
1899+c, tdbSNP:199876716
1907+a, gdbSNP:147201977
1917+c, tdbSNP:140501683
1936+c, tdbSNP:201457594
1943+a, cdbSNP:149706655
1964+a, gdbSNP:281875296
1967+a, gdbSNP:281875305
1975+a, gdbSNP:144618753
1980+c, gdbSNP:75928689
1995+c, gdbSNP:148472763
2018+a, gdbSNP:281875286
2026+a, gdbSNP:121908473
2076+dbSNP:
2076+g, tdbSNP:142282539
2094+g, tdbSNP:150203373
2097+c, tdbSNP:146779903
2135+a, cdbSNP:140628579
2151+dbSNP:
2151+a, gdbSNP:144282342
2160+c, tdbSNP:3124768
2231+dbSNP:
2231+c, tdbSNP:281875299
2241+c, tdbSNP:36221216
2248+c, tdbSNP:150234885
2254+a, gdbSNP:34256013
2260+c, gdbSNP:281875290
2274+c, tdbSNP:36221217
2296+c, gdbSNP:28647808
2318+a, gdbSNP:36090624
2323+a, g, tdbSNP:60398774
2343+c, tdbSNP:143573766
2344+a, gdbSNP:34569244
2350+c, tdbSNP:201704847
2359+c, tdbSNP:147166780
2360+g, tdbSNP:138699340
2379+a, cdbSNP:141265567
2417+dbSNP:
2417+a, gdbSNP:281875335
2420+a, gdbSNP:150764227
2423+a, gdbSNP:117943654
2430+c, gdbSNP:199741568
2452+c, tdbSNP:139214644
2453+a, gdbSNP:149953167
2456+c, tdbSNP:281875295
2461+a, tdbSNP:281875307
2501..2502+, gdbSNP:34245310
2518+c, tdbSNP:121908475
2531+c, tdbSNP:201605295
2551+dbSNP:
2551+c, tdbSNP:146314458
2611+a, cdbSNP:138014548
2639+c, tdbSNP:41314453
2661+c, tdbSNP:144178018
2662+a, gdbSNP:36221451
2698+dbSNP:
2698+a, gdbSNP:148734700
2716+c, tdbSNP:281875300
2724+a, gdbSNP:3124767
2828+c, tdbSNP:201607490
2938+dbSNP:
2938+a, gdbSNP:34104386
2952+c, tdbSNP:36221472
2977+a, gdbSNP:200125026
2989+a, gdbSNP:140639242
2996+a, gdbSNP:201106433
3024+c, tdbSNP:147112200
3130+dbSNP:
3130+a, gdbSNP:147732725
3143+a, gdbSNP:685523
3152+c, tdbSNP:78977446
3167+a, c, gdbSNP:281875301
3168+c, tdbSNP:145728650
3169+a, gdbSNP:138742754
3202+dbSNP:
3202+a, gdbSNP:201241072
3271+c, tdbSNP:149265456
3295+g, tdbSNP:121908468
3298+c, tdbSNP:143568784
3305+a, gdbSNP:200273776
3333+dbSNP:
3333+c, tdbSNP:148031420
3334+a, gdbSNP:141811556
3354+c, tdbSNP:28641026
3359+a, gdbSNP:139951127
3380+a, gdbSNP:142779872
3388+a, gdbSNP:36222275
3422+c, tdbSNP:139808736
3447+a, gdbSNP:149794949
3453+c, tdbSNP:145835995
3497+dbSNP:
3497+c, tdbSNP:148560341
3514+g, tdbSNP:121908472
3541+a, gdbSNP:28503257
3551+c, tdbSNP:142607772
3552+a, gdbSNP:34934621
3583+c, gdbSNP:151138896
3594+a, gdbSNP:36222579
3603+a, gdbSNP:200349242
3612+a, gdbSNP:150322366
3615+a, gdbSNP:36222580
3622+c, tdbSNP:142572218
3654+c, tdbSNP:138488999
3668+a, gdbSNP:138770906
3702+dbSNP:
3702+c, tdbSNP:200481038
3731+a, gdbSNP:61751476
3741+c, tdbSNP:199810396
3792+a, gdbSNP:146073007
3811+c, tdbSNP:281875340
3849+a, gdbSNP:148715397
3867+c, tdbSNP:200547311
3882+c, tdbSNP:186236347
3889+c, tdbSNP:141494468
3901+a, gdbSNP:150853306
3938+a, gdbSNP:139286990
3955+c, tdbSNP:148500446
3956+c, tdbSNP:200122302
3984+c, tdbSNP:147292523
3985+a, gdbSNP:192619276
4043+dbSNP:
4043+a, cdbSNP:141056078
4082+a, gdbSNP:121908474
4094+c, tdbSNP:200847393
4099+c, tdbSNP:281875339
4107+c, tdbSNP:144916851
4121+c, tdbSNP:36222894
4126+c, tdbSNP:148824378
4160+dbSNP:
4160+g, tdbSNP:281875303
4183+c, tdbSNP:142489534
4213+c, tdbSNP:150961996
4239+c, gdbSNP:140876480
4270+a, gdbSNP:144808448
4272+a, gdbSNP:138659427
4273+c, tdbSNP:140450669
4290+a, gdbSNP:36222899
4385+dbSNP:
4385+c, tdbSNP:142060916
4406+a, gdbSNP:200645384
4450+c, tdbSNP:281875308
4454+g, tdbSNP:201841682
4480+a, gdbSNP:149354083
4482+g, tdbSNP:144662080
4507+a, gdbSNP:199856010
4509+a, cdbSNP:138416072
4548+dbSNP:
4548+c, gdbSNP:199775013
4559+a, tdbSNP:201687626
4634+, cdbSNP:35876612
4641+c, tdbSNP:201166759
4665+a, cdbSNP:1055432
4805+c, tdbSNP:180910039
4865+c, tdbSNP:36223202
4896+c, tdbSNP:142792179
Gene SymbolADAMTS13
Gene Synonym13; ADAM-TS; ADAM-TS13; ADAMTS-13; C9orf8; TTP; vWF-CP; VWFCP
Chromosome9
Locus Map9q34
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_139025 Homo sapiens ADAM metallopeptidase with thrombospondin type 1 motif, 13 (ADAMTS13), transcript variant 1, mRNA. Full Length $1729.35
ORF Sequence $1499.40
NM_139026 Homo sapiens ADAM metallopeptidase with thrombospondin type 1 motif, 13 (ADAMTS13), transcript variant 3, mRNA. Full Length $1638.00
ORF Sequence $1408.05
NM_139027 Homo sapiens ADAM metallopeptidase with thrombospondin type 1 motif, 13 (ADAMTS13), transcript variant 2, mRNA. Full Length $1670.55
ORF Sequence $1440.60
Title Role of reduced ADAMTS13 in arterial ischemic stroke: a pediatric cohort study .
Author Lambers,M., Goldenberg,N.A., Kenet,G., Kirkham,F.J., Manner,D., Bernard,T., Mesters,R.M., Junker,R., Stoll,M. and Nowak-Gottl,U.
Journal Ann. Neurol. 73 (1), 58-64 (2013)
Title Cyclosporin A impairs the secretion and activity of ADAMTS13 (a disintegrin and metalloprotease with thrombospondin type 1 repeat) .
Author Hershko,K., Simhadri,V.L., Blaisdell,A., Hunt,R.C., Newell,J., Tseng,S.C., Hershko,A.Y., Choi,J.W., Sauna,Z.E., Wu,A., Bram,R.J., Komar,A.A. and Kimchi-Sarfaty,C.
Journal J. Biol. Chem. 287 (53), 44361-44371 (2012)
Title Protective anti-inflammatory effect of ADAMTS13 on myocardial ischemia/reperfusion injury in mice .
Author De Meyer,S.F., Savchenko,A.S., Haas,M.S., Schatzberg,D., Carroll,M.C., Schiviz,A., Dietrich,B., Rottensteiner,H., Scheiflinger,F. and Wagner,D.D.
Journal Blood 120 (26), 5217-5223 (2012)
Title Simultaneous exposure of sites in von Willebrand factor for glycoprotein Ib binding and ADAMTS13 cleavage: studies with ristocetin .
Author Chen,J., Ling,M., Fu,X., Lopez,J.A. and Chung,D.W.
Journal Arterioscler. Thromb. Vasc. Biol. 32 (11), 2625-2630 (2012)
Title Light chain of factor VIII is sufficient for accelerating cleavage of von Willebrand factor by ADAMTS13 metalloprotease .
Author Cao,W., Sabatino,D.E., Altynova,E., Lange,A.M., Casina,V.C., Camire,R.M. and Zheng,X.L.
Journal J. Biol. Chem. 287 (39), 32459-32466 (2012)
Title Purification of human von Willebrand factor-cleaving protease and its identification as a new member of the metalloproteinase family .
Author Fujikawa,K., Suzuki,H., McMullen,B. and Chung,D.
Journal Blood 98 (6), 1662-1666 (2001)
Title Partial amino acid sequence of purified von Willebrand factor-cleaving protease .
Author Gerritsen,H.E., Robles,R., Lammle,B. and Furlan,M.
Journal Blood 98 (6), 1654-1661 (2001)
Title ADAMTS: a novel family of extracellular matrix proteases .
Author Tang,B.L.
Journal Int. J. Biochem. Cell Biol. 33 (1), 33-44 (2001)
Title Physiologic cleavage of von Willebrand factor by a plasma protease is dependent on its conformation and requires calcium ion .
Author Tsai,H.M.
Journal Blood 87 (10), 4235-4244 (1996)
Title Partial purification and characterization of a protease from human plasma cleaving von Willebrand factor to fragments produced by in vivo proteolysis .
Author Furlan,M., Robles,R. and Lammle,B.
Journal Blood 87 (10), 4223-4234 (1996)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878