• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ADAM metallopeptidase with thrombospondin type 1 motif, 13 (ADAMTS13), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu27537 Homo sapiens ADAM metallopeptidase with thrombospondin type 1 motif, 13 (ADAMTS13), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand TBD -1
OHu27537C Homo sapiens ADAM metallopeptidase with thrombospondin type 1 motif, 13 (ADAMTS13), transcript variant 1, mRNA. Customized vector On-demand TBD -1

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_139025.4, 525313719
Length 4284 bp
Structure linear
Update Date 26-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens ADAM metallopeptidase with thrombospondin type 1 motif, 13 (ADAMTS13), transcript variant 1, mRNA.
Product A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform 1 preproprotein
Comment

Summary: This gene encodes a member of a family of proteins containing several distinct regions, including a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. The enzyme encoded by this gene specifically cleaves von Willebrand Factor (vWF). Defects in this gene are associated with thrombotic thrombocytopenic purpura. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013].


Transcript Variant: This variant (1) represents the longest transcript and encodes the longest isoform (1).

RefSeq NP_620594.1
CDS 445..4728
Misc Feature(1)352..354
Misc Feature(2)352..354
Misc Feature(3)365
Misc Feature(4)682..1293
Misc Feature(5)order(1114..1119,1126..1128,1144..1146)
Misc Feature(6)1603..1761
Misc Feature(7)1762..2112
Misc Feature(8)1936..1944
Misc Feature(9)2110..2499
Exon (1)1..549
Gene:ADAMTS13
Gene Synonym:ADAM-TS13; ADAMTS-13; C9orf8; vWF-CP; VWFCP
Exon (2)550..616
Gene:ADAMTS13
Gene Synonym:ADAM-TS13; ADAMTS-13; C9orf8; vWF-CP; VWFCP
Exon (3)617..774
Gene:ADAMTS13
Gene Synonym:ADAM-TS13; ADAMTS-13; C9orf8; vWF-CP; VWFCP
Exon (4)775..858
Gene:ADAMTS13
Gene Synonym:ADAM-TS13; ADAMTS-13; C9orf8; vWF-CP; VWFCP
Exon (5)859..983
Gene:ADAMTS13
Gene Synonym:ADAM-TS13; ADAMTS-13; C9orf8; vWF-CP; VWFCP
Exon (6)984..1130
Gene:ADAMTS13
Gene Synonym:ADAM-TS13; ADAMTS-13; C9orf8; vWF-CP; VWFCP
Exon (7)1131..1268
Gene:ADAMTS13
Gene Synonym:ADAM-TS13; ADAMTS-13; C9orf8; vWF-CP; VWFCP
Exon (8)1269..1431
Gene:ADAMTS13
Gene Synonym:ADAM-TS13; ADAMTS-13; C9orf8; vWF-CP; VWFCP
Exon (9)1432..1536
Gene:ADAMTS13
Gene Synonym:ADAM-TS13; ADAMTS-13; C9orf8; vWF-CP; VWFCP
Exon (10)1537..1688
Gene:ADAMTS13
Gene Synonym:ADAM-TS13; ADAMTS-13; C9orf8; vWF-CP; VWFCP
Exon (11)1689..1752
Gene:ADAMTS13
Gene Synonym:ADAM-TS13; ADAMTS-13; C9orf8; vWF-CP; VWFCP
Exon (12)1753..1879
Gene:ADAMTS13
Gene Synonym:ADAM-TS13; ADAMTS-13; C9orf8; vWF-CP; VWFCP
Exon (13)1880..2028
Gene:ADAMTS13
Gene Synonym:ADAM-TS13; ADAMTS-13; C9orf8; vWF-CP; VWFCP
Exon (14)2029..2149
Gene:ADAMTS13
Gene Synonym:ADAM-TS13; ADAMTS-13; C9orf8; vWF-CP; VWFCP
Exon (15)2150..2230
Gene:ADAMTS13
Gene Synonym:ADAM-TS13; ADAMTS-13; C9orf8; vWF-CP; VWFCP
Exon (16)2231..2412
Gene:ADAMTS13
Gene Synonym:ADAM-TS13; ADAMTS-13; C9orf8; vWF-CP; VWFCP
Exon (17)2413..2548
Gene:ADAMTS13
Gene Synonym:ADAM-TS13; ADAMTS-13; C9orf8; vWF-CP; VWFCP
Exon (18)2549..2678
Gene:ADAMTS13
Gene Synonym:ADAM-TS13; ADAMTS-13; C9orf8; vWF-CP; VWFCP
Exon (19)2679..2864
Gene:ADAMTS13
Gene Synonym:ADAM-TS13; ADAMTS-13; C9orf8; vWF-CP; VWFCP
Exon (20)2865..3054
Gene:ADAMTS13
Gene Synonym:ADAM-TS13; ADAMTS-13; C9orf8; vWF-CP; VWFCP
Exon (21)3055..3175
Gene:ADAMTS13
Gene Synonym:ADAM-TS13; ADAMTS-13; C9orf8; vWF-CP; VWFCP
Exon (22)3176..3305
Gene:ADAMTS13
Gene Synonym:ADAM-TS13; ADAMTS-13; C9orf8; vWF-CP; VWFCP
Exon (23)3306..3488
Gene:ADAMTS13
Gene Synonym:ADAM-TS13; ADAMTS-13; C9orf8; vWF-CP; VWFCP
Exon (24)3489..3693
Gene:ADAMTS13
Gene Synonym:ADAM-TS13; ADAMTS-13; C9orf8; vWF-CP; VWFCP
Exon (25)3694..4012
Gene:ADAMTS13
Gene Synonym:ADAM-TS13; ADAMTS-13; C9orf8; vWF-CP; VWFCP
Exon (26)4013..4159
Gene:ADAMTS13
Gene Synonym:ADAM-TS13; ADAMTS-13; C9orf8; vWF-CP; VWFCP
Exon (27)4160..4336
Gene:ADAMTS13
Gene Synonym:ADAM-TS13; ADAMTS-13; C9orf8; vWF-CP; VWFCP
Exon (28)4337..4521
Gene:ADAMTS13
Gene Synonym:ADAM-TS13; ADAMTS-13; C9orf8; vWF-CP; VWFCP
Exon (29)4522..4951
Gene:ADAMTS13
Gene Synonym:ADAM-TS13; ADAMTS-13; C9orf8; vWF-CP; VWFCP
Translation MHQRHPRARCPPLCVAGILACGFLLGCWGPSHFQQSCLQALEPQAVSSYLSPGAPLKGRP PSPGFQRQRQRQRRAAGGILHLELLVAVGPDVFQAHQEDTERYVLTNLNIGAELLRDPSL GAQFRVHLVKMVILTEPEGAPNITANLTSSLLSVCGWSQTINPEDDTDPGHADLVLYITR FDLELPDGNRQVRGVTQLGGACSPTWSCLITEDTGFDLGVTIAHEIGHSFGLEHDGAPGS GCGPSGHVMASDGAAPRAGLAWSPCSRRQLLSLLSAGRARCVWDPPRPQPGSAGHPPDAQ PGLYYSANEQCRVAFGPKAVACTFAREHLDMCQALSCHTDPLDQSSCSRLLVPLLDGTEC GVEKWCSKGRCRSLVELTPIAAVHGRWSSWGPRSPCSRSCGGGVVTRRRQCNNPRPAFGG RACVGADLQAEMCNTQACEKTQLEFMSQQCARTDGQPLRSSPGGASFYHWGAAVPHSQGD ALCRHMCRAIGESFIMKRGDSFLDGTRCMPSGPREDGTLSLCVSGSCRTFGCDGRMDSQQ VWDRCQVCGGDNSTCSPRKGSFTAGRAREYVTFLTVTPNLTSVYIANHRPLFTHLAVRIG GRYVVAGKMSISPNTTYPSLLEDGRVEYRVALTEDRLPRLEEIRIWGPLQEDADIQVYRR YGEEYGNLTRPDITFTYFQPKPRQAWVWAAVRGPCSVSCGAGLRWVNYSCLDQARKELVE TVQCQGSQQPPAWPEACVLEPCPPYWAVGDFGPCSASCGGGLRERPVRCVEAQGSLLKTL PPARCRAGAQQPAVALETCNPQPCPARWEVSEPSSCTSAGGAGLALENETCVPGADGLEA PVTEGPGSVDEKLPAPEPCVGMSCPPGWGHLDATSAGEKAPSPWGSIRTGAQAAHVWTPA AGSCSVSCGRGLMELRFLCMDSALRVPVQEELCGLASKPGSRREVCQAVPCPARWQYKLA ACSVSCGRGVVRRILYCARAHGEDDGEEILLDTQCQGLPRPEPQEACSLEPCPPRWKVMS LGPCSASCGLGTARRSVACVQLDQGQDVEVDEAACAALVRPEASVPCLIADCTYRWHVGT WMECSVSCGDGIQRRRDTCLGPQAQAPVPADFCQHLPKPVTVRGCWAGPCVGQGTPSLVP HEEAAAPGRTTATPAGASLEWSQARGLLFSPAPQPRRLLPGPQENSVQSSACGRQHLEPT GTIDMRGPGQADCAVAIGRPLGEVVTLRVLESSLNCSAGDMLLLWGRLTWRKMCRKLLDM TFSSKTNTLVVRQRCGRPGGGVLLRYGSQLAPETFYRECDMQLFGPWGEIVSPSLSPATS NAGGCRLFINVAPHARIAIHALATNMGAGTEGANASYILIRDTHSLRTTAFHGQQVLYWE SESSQAEMEFSEGFLKAQASLRGQYWTLQSWVPEMQDPQSWKGKEGT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
4939+c, tdbSNP:372254656
Gene SymbolADAMTS13
Gene SynonymADAM-TS13; ADAMTS-13; C9orf8; vWF-CP; VWFCP
Chromosome9
Locus Map9q34
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_139025 Homo sapiens ADAM metallopeptidase with thrombospondin type 1 motif, 13 (ADAMTS13), transcript variant 1, mRNA. On-demand TBD TBD
NM_139025 Homo sapiens ADAM metallopeptidase with thrombospondin type 1 motif, 13 (ADAMTS13), transcript variant 1, mRNA. On-demand TBD TBD
NM_139025 Homo sapiens ADAM metallopeptidase with thrombospondin type 1 motif, 13 (ADAMTS13), transcript variant 1, mRNA. On-demand TBD TBD
Title Single particle tracking of ADAMTS13 (a disintegrin and metalloprotease with thrombospondin type-1 repeats) molecules on endothelial von Willebrand factor strings .
Author De Ceunynck K, Rocha S, De Meyer SF, Sadler JE, Uji-i H, Deckmyn H, Hofkens J and Vanhoorelbeke K.
Journal J. Biol. Chem. 289 (13), 8903-8915 (2014)
Title Cloning, expression, and functional characterization of the von Willebrand factor-cleaving protease (ADAMTS13) .
Author Plaimauer B, Zimmermann K, Volkel D, Antoine G, Kerschbaumer R, Jenab P, Furlan M, Gerritsen H, Lammle B, Schwarz HP and Scheiflinger F.
Journal Blood 100 (10), 3626-3632 (2002)
Title Cloning, expression analysis, and structural characterization of seven novel human ADAMTSs, a family of metalloproteinases with disintegrin and thrombospondin-1 domains .
Author Cal S, Obaya AJ, Llamazares M, Garabaya C, Quesada V and Lopez-Otin C.
Journal Gene 283 (1-2), 49-62 (2002)
Title Von Willebrand factor-cleaving protease and Upshaw-Schulman syndrome .
Author Fujimura Y, Matsumoto M, Yagi H, Yoshioka A, Matsui T and Titani K.
Journal Int. J. Hematol. 75 (1), 25-34 (2002)
Title Structure of von Willebrand factor-cleaving protease (ADAMTS13), a metalloprotease involved in thrombotic thrombocytopenic purpura .
Author Zheng X, Chung D, Takayama TK, Majerus EM, Sadler JE and Fujikawa K.
Journal J. Biol. Chem. 276 (44), 41059-41063 (2001)
Title Mutations in a member of the ADAMTS gene family cause thrombotic thrombocytopenic purpura .
Author Levy GG, Nichols WC, Lian EC, Foroud T, McClintick JN, McGee BM, Yang AY, Siemieniak DR, Stark KR, Gruppo R, Sarode R, Shurin SB, Chandrasekaran V, Stabler SP, Sabio H, Bouhassira EE, Upshaw JD Jr, Ginsburg D and Tsai HM.
Journal Nature 413 (6855), 488-494 (2001)
Title A novel human metalloprotease synthesized in the liver and secreted into the blood: possibly, the von Willebrand factor-cleaving protease? .
Author Soejima K, Mimura N, Hirashima M, Maeda H, Hamamoto T, Nakagaki T and Nozaki C.
Journal J. Biochem. 130 (4), 475-480 (2001)
Title Purification of human von Willebrand factor-cleaving protease and its identification as a new member of the metalloproteinase family .
Author Fujikawa K, Suzuki H, McMullen B and Chung D.
Journal Blood 98 (6), 1662-1666 (2001)
Title Partial amino acid sequence of purified von Willebrand factor-cleaving protease .
Author Gerritsen HE, Robles R, Lammle B and Furlan M.
Journal Blood 98 (6), 1654-1661 (2001)
Title Partial purification and characterization of a protease from human plasma cleaving von Willebrand factor to fragments produced by in vivo proteolysis .
Author Furlan M, Robles R and Lammle B.
Journal Blood 87 (10), 4223-4234 (1996)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.