• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 (SMARCA2), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_139045 Homo sapiens SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 (SMARCA2), transcript variant 2, mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_139045.3, 574957241
Length 5838 bp
Structure linear
Update Date 05-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 (SMARCA2), transcript variant 2, mRNA.
Product probable global transcription activator SNF2L2 isoform b
Comment

Summary: The protein encoded by this gene is a member of the SWI/SNF family of proteins and is highly similar to the brahma protein of Drosophila. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. Alternatively spliced transcript variants encoding different isoforms have been found for this gene, which contains a trinucleotide repeat (CAG) length polymorphism. [provided by RefSeq, Jan 2014].


Transcript Variant: This variant (2) lacks an alternate in-frame exon in the coding region, compared to variant 1, resulting in a shorter protein (isoform a).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_620614.2
CDS 223..4941
Misc Feature(1)220..222
Misc Feature(2)340..744
Misc Feature(3)340..744
Misc Feature(4)736..846
Misc Feature(5)745..747
Misc Feature(6)1207..1209
Misc Feature(7)1207..1209
Misc Feature(8)1528..1746
Misc Feature(9)1981..1983
Misc Feature(10)1984..2118
Misc Feature(11)1984..1986
Misc Feature(12)1993..1995
Misc Feature(13)2065..2067
Misc Feature(14)2101..2103
Misc Feature(15)2140..2142
Misc Feature(16)2146..2148
Misc Feature(17)2173..2175
Misc Feature(18)2176..2178
Misc Feature(19)2401..3288
Misc Feature(20)2452..2871
Misc Feature(21)2476..2490
Misc Feature(22)2773..2784
Misc Feature(23)2773..2784
Misc Feature(24)3088..3090
Misc Feature(25)3211..3213
Misc Feature(26)3217..3219
Misc Feature(27)3340..3738
Misc Feature(28)order(3442..3453,3511..3516,3598..3606)
Misc Feature(29)order(3622..3624,3685..3687,3697..3699,3706..3708)
Misc Feature(30)3997..4200
Misc Feature(31)4219..>4407
Misc Feature(32)order(4303..4305,4330..4332,4339..4341)
Misc Feature(33)4351..4353
Misc Feature(34)4366..4686
Misc Feature(35)4420..4422
Misc Feature(36)4423..4425
Misc Feature(37)order(4459..4461,4474..4476,4483..4485,4600..4602,
Misc Feature(38)4702..4704
Misc Feature(39)4714..4716
Misc Feature(40)4750..4752
Misc Feature(41)4831..4833
Misc Feature(42)4834..4836
Misc Feature(43)4852..4854
Misc Feature(44)4858..4860
Misc Feature(45)4870..4872
Misc Feature(46)4870..4872
Misc Feature(47)4882..4884
Misc Feature(48)4882..4884
Exon (1)1..186
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (2)187..447
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (3)448..577
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (4)578..1012
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (5)1013..1268
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (6)1269..1395
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (7)1396..1569
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (8)1570..1743
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (9)1744..1914
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (10)1915..1968
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (11)1969..2099
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (12)2100..2157
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (13)2158..2258
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (14)2259..2406
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (15)2407..2570
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (16)2571..2637
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (17)2638..2748
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (18)2749..2991
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (19)2992..3105
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (20)3106..3213
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (21)3214..3300
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (22)3301..3347
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (23)3348..3514
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (24)3515..3678
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (25)3679..3906
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (26)3907..3984
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (27)3985..4203
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (28)4204..4421
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (29)4422..4527
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (30)4528..4629
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (31)4630..4762
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (32)4763..4905
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (33)4906..5826
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Translation MSTPTDPGAMPHPGPSPGPGPSPGPILGPSPGPGPSPGSVHSMMGPSPGPPSVSHPMPTM GSTDFPQEGMHQMHKPIDGIHDKGIVEDIHCGSMKGTGMRPPHPGMGPPQSPMDQHSQGY MSPHPSPLGAPEHVSSPMSGGGPTPPQMPPSQPGALIPGDPQAMSQPNRGPSPFSPVQLH QLRAQILAYKMLARGQPLPETLQLAVQGKRTLPGLQQQQQQQQQQQQQQQQQQQQQQQPQ QQPPQPQTQQQQQPALVNYNRPSGPGPELSGPSTPQKLPVPAPGGRPSPAPPAAAQPPAA AVPGPSVPQPAPGQPSPVLQLQQKQSRISPIQKPQGLDPVEILQEREYRLQARIAHRIQE LENLPGSLPPDLRTKATVELKALRLLNFQRQLRQEVVACMRRDTTLETALNSKAYKRSKR QTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVAGKIQKLSKAV ATWHANTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDRRLAYLLQQTDEYVANL TNLVWEHKQAQAAKEKKKRRRRKKKAEENAEGGESALGPDGEPIDESSQMSDLPVKVTHT ETGKVLFGPEAPKASQLDAWLEMNPGYEVAPRSDSEESDSDYEEEDEEEESSRQETEEKI LLDPNSEEVSEKDAKQIIETAKQDVDDEYSMQYSARGSQSYYTVAHAISERVEKQSALLI NGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIV PLSTLSNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHIL AKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLP TIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPE KVEYVIKCDMSALQKILYRHMQAKGILLTDGSEKDKKGKGGAKTLMNTIMQLRKICNHPY MFQHIEESFAEHLGYSNGVINGAELYRASGKFELLDRILPKLRATNHRVLLFCQMTSLMT IMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADT VVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQ AGMFDQKSSSHERRAFLQAILEHEEENEEEDEVPDDETLNQMIARREEEFDLFMRMDMDR RREDARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKIFGRGSRQRRDVDYSDAL TEKQWLRAIEDGNLEEMEEEVRLKKRKRRRNVDKDPAKEDVEKAKKRRGRPPAEKLSPNP PKLTKQMNAIIDTVINYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRN HKYRSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAKEEESEDESNE EEEEEDEEESESEAKSVKVKIKLNKKDDKGRDKGKGKKRPNRGKAKPVVSDFDSDEEQDE REQSEGSGTDDE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
161+dbSNP:
161+c, tdbSNP:184465681
193+dbSNP:
193+c, tdbSNP:368879989
196+a, gdbSNP:370082404
218+a, gdbSNP:10964468
249+a, gdbSNP:149689575
253+c, tdbSNP:145516397
273+c, gdbSNP:148865068
319+c, tdbSNP:146990134
340+a, gdbSNP:374826893
379+a, gdbSNP:191818866
396+a, gdbSNP:10964470
397+a, tdbSNP:138129490
399+a, gdbSNP:10964471
430+a, tdbSNP:143478968
453+dbSNP:
453+c, tdbSNP:148086416
464+a, cdbSNP:201962378
466+c, gdbSNP:141861118
468+c, tdbSNP:181403075
486+c, tdbSNP:370078162
546+a, tdbSNP:150630640
547+c, gdbSNP:374114848
585+dbSNP:
585+a, gdbSNP:372393164
602+c, tdbSNP:267602196
622+a, gdbSNP:201403629
662+a, gdbSNP:200749632
670+a, cdbSNP:187402350
681+a, gdbSNP:375996388
684+a, gdbSNP:61736900
704+c, tdbSNP:149394378
705+g, tdbSNP:146359524
722+c, gdbSNP:376294726
735+a, cdbSNP:148002538
783+a, gdbSNP:144501382
825+a, gdbSNP:199724104
854+c, tdbSNP:146164750
873+a, gdbSNP:13296982
888+a, gdbSNP:13296987
889..891+, cagdbSNP:376509101
891+a, gdbSNP:62639301
896+a, cdbSNP:145170448
899+a, cdbSNP:147609454
903+a, gdbSNP:142219087
905+a, cdbSNP:62534884
908+a, cdbSNP:184126259
911+a, cdbSNP:145635937
915+a, gdbSNP:149130789
917+a, cdbSNP:143245740
939+a, gdbSNP:10964525
951+a, gdbSNP:374998669
954+a, gdbSNP:368685869
969+a, gdbSNP:368518933
972+a, gdbSNP:62639302
975+a, gdbSNP:371645507
990+c, tdbSNP:187483148
1154+dbSNP:
1154+c, tdbSNP:377206552
1179+c, gdbSNP:368952400
1201+c, tdbSNP:200539576
1290+dbSNP:
1290+c, tdbSNP:369717922
1302+a, gdbSNP:138782877
1332+a, gdbSNP:372569895
1344+c, gdbSNP:138404604
1362+a, gdbSNP:375637363
1402+dbSNP:
1402+c, gdbSNP:1142229
1410+g, tdbSNP:372968761
1434+a, gdbSNP:377165505
1455+c, tdbSNP:142963920
1488+a, tdbSNP:146138142
1551+a, gdbSNP:140011686
1553..1554+, gdbSNP:35724685
1580+dbSNP:
1580+a, gdbSNP:374927642
1584+g, tdbSNP:7020514
1585+a, gdbSNP:148805100
1644+a, gdbSNP:144434753
1656+a, gdbSNP:187300214
1733+a, gdbSNP:367813930
1759+dbSNP:
1759+a, gdbSNP:1142230
1773+a, gdbSNP:376510836
1785+a, gdbSNP:148410896
1821+a, cdbSNP:145129640
1959+dbSNP:
1959+a, gdbSNP:371544356
2028+dbSNP:
2028+c, tdbSNP:202136878
2040+g, tdbSNP:369716405
2043+c, tdbSNP:201735133
2049+a, gdbSNP:13288443
2052+a, gdbSNP:111606727
2058+c, tdbSNP:373497659
2076+c, tdbSNP:140464170
2081+a, gdbSNP:112486521
2112+dbSNP:
2112+c, tdbSNP:144414155
2184+dbSNP:
2184+a, gdbSNP:151212782
2205+a, cdbSNP:140384223
2235+a, gdbSNP:372686049
2249+a, tdbSNP:150383522
2274+dbSNP:
2274+c, tdbSNP:149890563
2343+a, cdbSNP:369051102
2344+a, gdbSNP:376376092
2348+c, tdbSNP:199989401
2358+a, gdbSNP:147739329
2371+c, gdbSNP:373755812
2373+c, tdbSNP:199549400
2434+dbSNP:
2434+c, tdbSNP:376431348
2454+c, tdbSNP:149169822
2466+c, tdbSNP:140551438
2477+c, gdbSNP:281875198
2486+a, gdbSNP:281875203
2489+c, tdbSNP:281875191
2547+c, tdbSNP:145668742
2565+c, tdbSNP:374332187
2697+dbSNP:
2697+a, cdbSNP:138319318
2772+dbSNP:
2772+g, tdbSNP:367639859
2773+c, gdbSNP:281875206
2775+c, tdbSNP:142930412
2776+a, gdbSNP:281875199
2778+a, cdbSNP:281875193
2783+a, gdbSNP:281875202
2785+c, gdbSNP:281875207
2807+a, gdbSNP:143351615
2809+c, gdbSNP:369724771
2863+c, gdbSNP:281875194
2864+g, tdbSNP:281875185
2865+c, gdbSNP:148360213
2870+c, tdbSNP:281875188
2895+c, tdbSNP:201306504
2955+a, gdbSNP:146829604
2994+dbSNP:
2994+a, gdbSNP:148034194
3037+c, tdbSNP:281875190
3059+c, tdbSNP:281875200
3060+a, tdbSNP:281875205
3081+a, gdbSNP:150917593
3130+dbSNP:
3130+a, gdbSNP:375473288
3151+c, tdbSNP:139445919
3155+a, tdbSNP:78915420
3158+a, gdbSNP:200463125
3200+a, gdbSNP:201946220
3381+dbSNP:
3381+a, gdbSNP:201232457
3387+c, tdbSNP:369919125
3391+c, tdbSNP:199759640
3406+c, tdbSNP:372318006
3453+g, tdbSNP:143428093
3489+a, gdbSNP:147154246
3504+a, gdbSNP:140418138
3535+dbSNP:
3535+c, tdbSNP:281875192
3536+c, gdbSNP:281875197
3537+c, tdbSNP:144342163
3566+c, tdbSNP:377073211
3594+g, tdbSNP:187902778
3617+a, gdbSNP:387907194
3626+c, tdbSNP:281875195
3658+a, cdbSNP:281875204
3660+c, tdbSNP:62534896
3695+dbSNP:
3695+a, tdbSNP:281875240
3697+c, gdbSNP:281875184
3698+a, g, tdbSNP:281875187
3707+a, gdbSNP:281875186
3732+g, tdbSNP:148467601
3768+a, gdbSNP:142044676
3777+c, tdbSNP:78868042
3784+c, gdbSNP:281875196
3824+c, tdbSNP:281875189
3826+g, tdbSNP:281875239
3827+g, tdbSNP:200774838
3836+a, gdbSNP:281875201
3859+c, tdbSNP:281875238
3886+g, tdbSNP:10137
3894+a, g, tdbSNP:6601
3924+dbSNP:
3924+a, gdbSNP:140458185
3973+g, tdbSNP:1803765
3990+dbSNP:
3990+a, gdbSNP:370403102
4029+a, gdbSNP:144212700
4047+a, gdbSNP:373570064
4065+c, tdbSNP:61736902
4116+a, gdbSNP:141291951
4194+a, gdbSNP:78274023
4228+dbSNP:
4228+c, gdbSNP:373954302
4251+a, g, tdbSNP:150227062
4281+c, tdbSNP:368433894
4289+c, tdbSNP:138891880
4311+a, cdbSNP:61736901
4328+a, gdbSNP:371901993
4339+a, gdbSNP:148991905
4426+dbSNP:
4426+c, gdbSNP:370103754
4545+dbSNP:
4545+c, tdbSNP:138542624
4548+a, gdbSNP:368897344
4579+a, gdbSNP:372383208
4581+a, cdbSNP:1803766
4608+a, gdbSNP:184913034
4647+dbSNP:
4647+c, tdbSNP:111380592
4662+a, gdbSNP:375477038
4680+c, gdbSNP:201825831
4684+a, tdbSNP:147135956
4688+c, gdbSNP:138684090
4758+a, gdbSNP:386447249
4758+c, tdbSNP:77070978
4806+dbSNP:
4806+c, gdbSNP:2296212
4813+c, tdbSNP:139124915
4814+a, gdbSNP:201798443
4818+c, tdbSNP:374750495
4827+a, tdbSNP:149931024
4867+c, gdbSNP:144110632
4885+a, gdbSNP:61736899
4893+a, gdbSNP:61761955
4899+c, tdbSNP:143522467
4903+c, tdbSNP:367755009
4904+a, gdbSNP:138760068
4911+dbSNP:
4911+a, g, tdbSNP:190172342
4929+a, gdbSNP:146702999
4932+a, tdbSNP:372976069
4947+a, gdbSNP:192980752
4955+a, tdbSNP:371424653
4967+a, gdbSNP:377168669
4977+c, gdbSNP:369265928
4999+c, tdbSNP:185669620
5021+c, tdbSNP:370531788
5035+g, tdbSNP:189476291
5079+a, c, tdbSNP:75720779
5122+c, tdbSNP:180701505
5146+a, gdbSNP:139076728
5157+c, tdbSNP:367814078
5204+c, tdbSNP:373674996
5225+c, tdbSNP:185399613
5242+, tdbSNP:3215772
5276+g, tdbSNP:143996657
5323+a, gdbSNP:370180389
5372+a, gdbSNP:17387924
5520+a, gdbSNP:369158564
5561+c, tdbSNP:7048532
5639+c, tdbSNP:45616134
complement(5657)-g, adbSNP:1061478
5667+c, tdbSNP:28374302
5773+a, cdbSNP:74587303
5801+a, gdbSNP:188397000
Gene SymbolSMARCA2
Gene SynonymBAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Chromosome9
Locus Map9p22.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001289398 Homo sapiens SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 (SMARCA2), transcript variant 5, mRNA. On-demand $399.00 14
NM_001289396 Homo sapiens SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 (SMARCA2), transcript variant 3, mRNA. On-demand TBD TBD
NM_001289399 Homo sapiens SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 (SMARCA2), transcript variant 6, mRNA. On-demand $449.00 14
NM_001289400 Homo sapiens SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 (SMARCA2), transcript variant 7, mRNA. On-demand $449.00 14
NM_139045 Homo sapiens SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 (SMARCA2), transcript variant 2, mRNA. On-demand TBD TBD
NM_001289397 Homo sapiens SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 (SMARCA2), transcript variant 4, mRNA. On-demand TBD TBD
NM_003070 Homo sapiens SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 (SMARCA2), transcript variant 1, mRNA. On-demand TBD TBD
Title Residual complexes containing SMARCA2 (BRM) underlie the oncogenic drive of SMARCA4 (BRG1) mutation .
Author Wilson BG, Helming KC, Wang X, Kim Y, Vazquez F, Jagani Z, Hahn WC and Roberts CW.
Journal Mol. Cell. Biol. 34 (6), 1136-1144 (2014)
Title Functional epigenetics approach identifies BRM/SMARCA2 as a critical synthetic lethal target in BRG1-deficient cancers .
Author Hoffman GR, Rahal R, Buxton F, Xiang K, McAllister G, Frias E, Bagdasarian L, Huber J, Lindeman A, Chen D, Romero R, Ramadan N, Phadke T, Haas K, Jaskelioff M, Wilson BG, Meyer MJ, Saenz-Vash V, Zhai H, Myer VE, Porter JA, Keen N, McLaughlin ME, Mickanin C, Roberts CW, Stegmeier F and Jagani Z.
Journal Proc. Natl. Acad. Sci. U.S.A. 111 (8), 3128-3133 (2014)
Title BRG1 and BRM chromatin-remodeling complexes regulate the hypoxia response by acting as coactivators for a subset of hypoxia-inducible transcription factor target genes .
Author Sena JA, Wang L and Hu CJ.
Journal Mol. Cell. Biol. 33 (19), 3849-3863 (2013)
Title A synthetic lethality-based strategy to treat cancers harboring a genetic deficiency in the chromatin remodeling factor BRG1 .
Author Oike T, Ogiwara H, Tominaga Y, Ito K, Ando O, Tsuta K, Mizukami T, Shimada Y, Isomura H, Komachi M, Furuta K, Watanabe S, Nakano T, Yokota J and Kohno T.
Journal Cancer Res. 73 (17), 5508-5518 (2013)
Title A genome-wide association study of chemotherapy-induced alopecia in breast cancer patients .
Author Chung,S., Low,S.K., Zembutsu,H., Takahashi,A., Kubo,M., Sasa,M. and Nakamura,Y.
Journal Breast Cancer Res. 15 (5), R81 (2013)
Title The hbrm and BRG-1 proteins, components of the human SNF/SWI complex, are phosphorylated and excluded from the condensed chromosomes during mitosis .
Author Muchardt C, Reyes JC, Bourachot B, Leguoy E and Yaniv M.
Journal EMBO J. 15 (13), 3394-3402 (1996)
Title A fission yeast gene mapping close to suc1 encodes a protein containing two bromodomains .
Author Aves SJ, Hindley J, Phear GA and Tongue N.
Journal Mol. Gen. Genet. 248 (4), 491-498 (1995)
Title Two human homologues of Saccharomyces cerevisiae SWI2/SNF2 and Drosophila brahma are transcriptional coactivators cooperating with the estrogen receptor and the retinoic acid receptor .
Author Chiba H, Muramatsu M, Nomoto A and Kato H.
Journal Nucleic Acids Res. 22 (10), 1815-1820 (1994)
Title Assignment of HBRM, the human homolog of S. cerevisiae SNF2/SWI2 and Drosophila brm genes, to chromosome region 9p23-p24, by in situ hybridization .
Author Muchardt C, Yaniv M and Mattei MG.
Journal Mamm. Genome 5 (4), 241-243 (1994)
Title A human homologue of Saccharomyces cerevisiae SNF2/SWI2 and Drosophila brm genes potentiates transcriptional activation by the glucocorticoid receptor .
Author Muchardt C and Yaniv M.
Journal EMBO J. 12 (11), 4279-4290 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.