• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 (SMARCA2), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_139045 Homo sapiens SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 (SMARCA2), transcript variant 2, mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_139045.2, 48255897
Length 5703 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 (SMARCA2), transcript variant 2, mRNA.
Product probable global transcription activator SNF2L2 isoform b
Comment

Summary: The protein encoded by this gene is a member of the SWI/SNF family of proteins and is highly similar to the brahma protein of Drosophila. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. Two transcript variants encoding different isoforms have been found for this gene, which contains a trinucleotide repeat (CAG) length polymorphism. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (2) lacks an alternate in-frame exon in the coding region, compared to variant 1, resulting in a shorter protein (isoform 2).

RefSeq NP_620614.2
CDS 100..4818
Misc Feature(1)97..99
Misc Feature(2)613..723
Misc Feature(3)613..723
Misc Feature(4)622..624
Misc Feature(5)1084..1086
Misc Feature(6)1084..1086
Misc Feature(7)<1450..1623
Misc Feature(8)1858..1860
Misc Feature(9)1861..1995
Misc Feature(10)1861..1863
Misc Feature(11)1870..1872
Misc Feature(12)1942..1944
Misc Feature(13)1978..1980
Misc Feature(14)2017..2019
Misc Feature(15)2023..2025
Misc Feature(16)2050..2052
Misc Feature(17)2053..2055
Misc Feature(18)2278..3165
Misc Feature(19)2329..2748
Misc Feature(20)2353..2367
Misc Feature(21)2650..2661
Misc Feature(22)2650..2661
Misc Feature(23)2965..2967
Misc Feature(24)3088..3090
Misc Feature(25)3094..3096
Misc Feature(26)3217..3615
Misc Feature(27)order(3319..3330,3388..3393,3475..3483)
Misc Feature(28)order(3499..3501,3562..3564,3574..3576,3583..3585)
Misc Feature(29)4228..4230
Misc Feature(30)4243..4563
Misc Feature(31)4297..4299
Misc Feature(32)4300..4302
Misc Feature(33)order(4336..4338,4351..4353,4360..4362,4477..4479,
Misc Feature(34)4579..4581
Misc Feature(35)4591..4593
Misc Feature(36)4627..4629
Misc Feature(37)4708..4710
Misc Feature(38)4711..4713
Misc Feature(39)4729..4731
Misc Feature(40)4735..4737
Misc Feature(41)4747..4749
Misc Feature(42)4747..4749
Misc Feature(43)4759..4761
Misc Feature(44)4759..4761
Exon (1)1..63
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (2)64..324
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (3)325..454
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (4)455..889
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (5)890..1145
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (6)1146..1272
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (7)1273..1446
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (8)1447..1620
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (9)1621..1791
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (10)1792..1845
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (11)1846..1976
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (12)1977..2034
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (13)2035..2135
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (14)2136..2283
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (15)2284..2447
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (16)2448..2514
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (17)2515..2625
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (18)2626..2868
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (19)2869..2982
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (20)2983..3090
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (21)3091..3177
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (22)3178..3224
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (23)3225..3391
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (24)3392..3555
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (25)3556..3783
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (26)3784..3861
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (27)3862..4080
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (28)4081..4298
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (29)4299..4404
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (30)4405..4506
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (31)4507..4639
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (32)4640..4782
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Exon (33)4783..5703
Gene:SMARCA2
Gene Synonym:BAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Translation MSTPTDPGAMPHPGPSPGPGPSPGPILGPSPGPGPSPGSVHSMMGPSPGPPSVSHPMPTM GSTDFPQEGMHQMHKPIDGIHDKGIVEDIHCGSMKGTGMRPPHPGMGPPQSPMDQHSQGY MSPHPSPLGAPEHVSSPMSGGGPTPPQMPPSQPGALIPGDPQAMSQPNRGPSPFSPVQLH QLRAQILAYKMLARGQPLPETLQLAVQGKRTLPGLQQQQQQQQQQQQQQQQQQQQQQQPQ QQPPQPQTQQQQQPALVNYNRPSGPGPELSGPSTPQKLPVPAPGGRPSPAPPAAAQPPAA AVPGPSVPQPAPGQPSPVLQLQQKQSRISPIQKPQGLDPVEILQEREYRLQARIAHRIQE LENLPGSLPPDLRTKATVELKALRLLNFQRQLRQEVVACMRRDTTLETALNSKAYKRSKR QTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVAGKIQKLSKAV ATWHANTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDRRLAYLLQQTDEYVANL TNLVWEHKQAQAAKEKKKRRRRKKKAEENAEGGESALGPDGEPIDESSQMSDLPVKVTHT ETGKVLFGPEAPKASQLDAWLEMNPGYEVAPRSDSEESDSDYEEEDEEEESSRQETEEKI LLDPNSEEVSEKDAKQIIETAKQDVDDEYSMQYSARGSQSYYTVAHAISERVEKQSALLI NGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIV PLSTLSNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHIL AKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLP TIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPE KVEYVIKCDMSALQKILYRHMQAKGILLTDGSEKDKKGKGGAKTLMNTIMQLRKICNHPY MFQHIEESFAEHLGYSNGVINGAELYRASGKFELLDRILPKLRATNHRVLLFCQMTSLMT IMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADT VVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQ AGMFDQKSSSHERRAFLQAILEHEEENEEEDEVPDDETLNQMIARREEEFDLFMRMDMDR RREDARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKIFGRGSRQRRDVDYSDAL TEKQWLRAIEDGNLEEMEEEVRLKKRKRRRNVDKDPAKEDVEKAKKRRGRPPAEKLSPNP PKLTKQMNAIIDTVINYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRN HKYRSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAKEEESEDESNE EEEEEDEEESESEAKSVKVKIKLNKKDDKGRDKGKGKKRPNRGKAKPVVSDFDSDEEQDE REQSEGSGTDDE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
38+dbSNP:
38+c, tdbSNP:184465681
95+dbSNP:
95+a, gdbSNP:10964468
126+a, gdbSNP:149689575
130+c, tdbSNP:145516397
150+a, gdbSNP:148865068
196+c, tdbSNP:146990134
256+a, gdbSNP:191818866
273+a, gdbSNP:10964470
274+a, tdbSNP:138129490
276+a, gdbSNP:10964471
307+a, tdbSNP:143478968
330+dbSNP:
330+c, tdbSNP:148086416
341+a, cdbSNP:201962378
343+c, gdbSNP:141861118
345+c, tdbSNP:181403075
423+a, tdbSNP:150630640
499+dbSNP:
499+a, gdbSNP:201403629
539+a, gdbSNP:200749632
547+a, cdbSNP:187402350
561+a, gdbSNP:61736900
581+c, tdbSNP:149394378
582+g, tdbSNP:146359524
612+a, cdbSNP:148002538
660+a, gdbSNP:144501382
702+a, gdbSNP:199724104
731+c, tdbSNP:146164750
750+a, gdbSNP:13296982
753+a, gdbSNP:148600532
765+a, gdbSNP:13296987
766..768+, cagdbSNP:113070757
768..769+, gcadbSNP:34035317
768+a, gdbSNP:62639301
771+a, gdbSNP:139102413
773+a, cdbSNP:145170448
776+a, cdbSNP:147609454
780+a, gdbSNP:142219087
782+a, cdbSNP:62534884
785+a, cdbSNP:184126259
786+a, gdbSNP:146132694
788+a, cdbSNP:145635937
792+a, gdbSNP:149130789
794+a, cdbSNP:143245740
816+a, gdbSNP:10964525
849+a, gdbSNP:62639302
867+c, tdbSNP:187483148
1078+dbSNP:
1078+c, tdbSNP:200539576
1179+dbSNP:
1179+a, gdbSNP:138782877
1221+c, gdbSNP:138404604
1279+dbSNP:
1279+c, gdbSNP:1142229
1332+c, tdbSNP:142963920
1365+a, tdbSNP:146138142
1428+a, gdbSNP:140011686
1430..1431+, gdbSNP:35724685
1461+dbSNP:
1461+g, tdbSNP:7020514
1462+a, gdbSNP:148805100
1521+a, gdbSNP:144434753
1533+a, gdbSNP:187300214
1636+dbSNP:
1636+a, gdbSNP:1142230
1662+a, gdbSNP:148410896
1698+a, cdbSNP:145129640
1905+dbSNP:
1905+c, tdbSNP:202136878
1920+c, tdbSNP:201735133
1926+a, gdbSNP:13288443
1929+a, gdbSNP:111606727
1953+c, tdbSNP:140464170
1958+a, gdbSNP:112486521
1989+dbSNP:
1989+c, tdbSNP:144414155
2061+dbSNP:
2061+a, gdbSNP:151212782
2082+a, cdbSNP:140384223
2126+a, tdbSNP:150383522
2151+dbSNP:
2151+c, tdbSNP:149890563
2225+c, tdbSNP:199989401
2235+a, gdbSNP:147739329
2250+c, tdbSNP:199549400
2331+dbSNP:
2331+c, tdbSNP:149169822
2343+c, tdbSNP:140551438
2354+c, gdbSNP:281875198
2363+a, gdbSNP:281875203
2366+c, tdbSNP:281875191
2424+c, tdbSNP:145668742
2574+dbSNP:
2574+a, cdbSNP:138319318
2650+dbSNP:
2650+c, gdbSNP:281875206
2652+c, tdbSNP:142930412
2653+a, gdbSNP:281875199
2655+a, cdbSNP:281875193
2660+a, gdbSNP:281875202
2662+c, gdbSNP:281875207
2684+a, gdbSNP:143351615
2740+c, gdbSNP:281875194
2741+g, tdbSNP:281875185
2742+c, gdbSNP:148360213
2747+c, tdbSNP:281875188
2772+c, tdbSNP:201306504
2832+a, gdbSNP:146829604
2871+dbSNP:
2871+a, gdbSNP:148034194
2914+c, tdbSNP:281875190
2936+c, tdbSNP:281875200
2937+a, tdbSNP:281875205
2958+a, gdbSNP:150917593
3028+dbSNP:
3028+c, tdbSNP:139445919
3032+a, tdbSNP:78915420
3035+a, gdbSNP:200463125
3077+a, gdbSNP:201946220
3258+dbSNP:
3258+a, gdbSNP:201232457
3268+c, tdbSNP:199759640
3330+g, tdbSNP:143428093
3366+a, gdbSNP:147154246
3381+a, gdbSNP:140418138
3412+dbSNP:
3412+c, tdbSNP:281875192
3413+c, gdbSNP:281875197
3414+c, tdbSNP:144342163
3471+g, tdbSNP:187902778
3503+c, tdbSNP:281875195
3535+a, cdbSNP:281875204
3537+c, tdbSNP:62534896
3572+dbSNP:
3572+a, tdbSNP:281875240
3574+c, gdbSNP:281875184
3575+a, g, tdbSNP:281875187
3584+a, gdbSNP:281875186
3609+g, tdbSNP:148467601
3645+a, gdbSNP:142044676
3654+c, tdbSNP:78868042
3661+c, gdbSNP:281875196
3701+c, tdbSNP:281875189
3703+g, tdbSNP:281875239
3704+g, tdbSNP:200774838
3713+a, gdbSNP:281875201
3736+c, tdbSNP:281875238
3763+g, tdbSNP:10137
3771+a, g, tdbSNP:6601
3801+dbSNP:
3801+a, gdbSNP:140458185
3850+g, tdbSNP:1803765
3906+dbSNP:
3906+a, gdbSNP:144212700
3942+c, tdbSNP:61736902
3993+a, gdbSNP:141291951
4071+a, gdbSNP:78274023
4128+dbSNP:
4128+a, g, tdbSNP:150227062
4166+c, tdbSNP:138891880
4188+a, cdbSNP:61736901
4216+a, gdbSNP:148991905
4422+dbSNP:
4422+c, tdbSNP:138542624
4458+a, cdbSNP:1803766
4485+a, gdbSNP:184913034
4524+dbSNP:
4524+c, tdbSNP:111380592
4557+c, gdbSNP:201825831
4561+a, tdbSNP:147135956
4565+c, gdbSNP:138684090
4635+c, tdbSNP:77070978
4683+dbSNP:
4683+c, gdbSNP:2296212
4690+c, tdbSNP:139124915
4691+a, gdbSNP:201798443
4704+a, tdbSNP:149931024
4744+c, gdbSNP:144110632
4762+a, gdbSNP:61736899
4770+a, gdbSNP:61761955
4776+c, tdbSNP:143522467
4781+a, gdbSNP:138760068
4788+dbSNP:
4788+g, tdbSNP:190172342
4806+a, gdbSNP:146702999
4824+a, gdbSNP:192980752
4876+c, tdbSNP:185669620
4912+g, tdbSNP:189476291
4956+c, tdbSNP:75720779
4999+c, tdbSNP:180701505
5023+a, gdbSNP:139076728
5102+c, tdbSNP:185399613
5117+, tdbSNP:3215772
5153+g, tdbSNP:143996657
5249+a, gdbSNP:17387924
5438+c, tdbSNP:7048532
5516+c, tdbSNP:45616134
5534+a, gdbSNP:1061478
5544+c, tdbSNP:28374302
5650+a, cdbSNP:74587303
5678+a, gdbSNP:188397000
Gene SymbolSMARCA2
Gene SynonymBAF190; BRM; hBRM; hSNF2a; NCBRS; SNF2; SNF2L2; SNF2LA; Sth1p; SWI2
Chromosome9
Locus Map9p22.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_003070 Homo sapiens SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 (SMARCA2), transcript variant 1, mRNA. On-demand TBD TBD
NM_139045 Homo sapiens SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 (SMARCA2), transcript variant 2, mRNA. On-demand TBD TBD
Title Downregulation of SWI/SNF chromatin remodeling factor subunits modulates cisplatin cytotoxicity .
Author Kothandapani,A., Gopalakrishnan,K., Kahali,B., Reisman,D. and Patrick,S.M.
Journal Exp. Cell Res. 318 (16), 1973-1986 (2012)
Title Heterozygous missense mutations in SMARCA2 cause Nicolaides-Baraitser syndrome .
Author Van Houdt,J.K., Nowakowska,B.A., Sousa,S.B., van Schaik,B.D., Seuntjens,E., Avonce,N., Sifrim,A., Abdul-Rahman,O.A., van den Boogaard,M.J., Bottani,A., Castori,M., Cormier-Daire,V., Deardorff,M.A., Filges,I., Fryer,A., Fryns,J.P., Gana,S., Garavelli,L., Gillessen-Kaesbach,G., Hall,B.D., Horn,D., Huylebroeck,D., Klapecki,J., Krajewska-Walasek,M., Kuechler,A., Lines,M.A., Maas,S., Macdermot,K.D., McKee,S., Magee,A., de Man,S.A., Moreau,Y., Morice-Picard,F., Obersztyn,E., Pilch,J., Rosser,E., Shannon,N., Stolte-Dijkstra,I., Van Dijck,P., Vilain,C., Vogels,A., Wakeling,E., Wieczorek,D., Wilson,L., Zuffardi,O., van Kampen,A.H., Devriendt,K., Hennekam,R. and Vermeesch,J.R.
Journal Nat. Genet. 44 (4), 445-449 (2012)
Title The glucocorticoid receptor and the coregulator Brm selectively modulate each other's occupancy and activity in a gene-specific manner .
Author Engel,K.B. and Yamamoto,K.R.
Journal Mol. Cell. Biol. 31 (16), 3267-3276 (2011)
Title MicroRNAs miR-199a-5p and -3p target the Brm subunit of SWI/SNF to generate a double-negative feedback loop in a variety of human cancers .
Author Sakurai,K., Furukawa,C., Haraguchi,T., Inada,K., Shiogama,K., Tagawa,T., Fujita,S., Ueno,Y., Ogata,A., Ito,M., Tsutsumi,Y. and Iba,H.
Journal Cancer Res. 71 (5), 1680-1689 (2011)
Title [Expression of BRG1 and BRM proteins in prostatic cancer] .
Author Liu,X.B., Sun,A.J., Wang,C. and Chen,L.R.
Journal Zhonghua Bing Li Xue Za Zhi 39 (9), 591-594 (2010)
Title The hbrm and BRG-1 proteins, components of the human SNF/SWI complex, are phosphorylated and excluded from the condensed chromosomes during mitosis .
Author Muchardt,C., Reyes,J.C., Bourachot,B., Leguoy,E. and Yaniv,M.
Journal EMBO J. 15 (13), 3394-3402 (1996)
Title A fission yeast gene mapping close to suc1 encodes a protein containing two bromodomains .
Author Aves,S.J., Hindley,J., Phear,G.A. and Tongue,N.
Journal Mol. Gen. Genet. 248 (4), 491-498 (1995)
Title Two human homologues of Saccharomyces cerevisiae SWI2/SNF2 and Drosophila brahma are transcriptional coactivators cooperating with the estrogen receptor and the retinoic acid receptor .
Author Chiba,H., Muramatsu,M., Nomoto,A. and Kato,H.
Journal Nucleic Acids Res. 22 (10), 1815-1820 (1994)
Title Assignment of HBRM, the human homolog of S. cerevisiae SNF2/SWI2 and Drosophila brm genes, to chromosome region 9p23-p24, by in situ hybridization .
Author Muchardt,C., Yaniv,M. and Mattei,M.G.
Journal Mamm. Genome 5 (4), 241-243 (1994)
Title A human homologue of Saccharomyces cerevisiae SNF2/SWI2 and Drosophila brm genes potentiates transcriptional activation by the glucocorticoid receptor .
Author Muchardt,C. and Yaniv,M.
Journal EMBO J. 12 (11), 4279-4290 (1993)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.