• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens AT rich interactive domain 1A (SWI-like) (ARID1A), transcript variant 2, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu23927 Homo sapiens AT rich interactive domain 1A (SWI-like) (ARID1A), transcript variant 2, mRNA. pcDNA3.1+-DYK On-demand TBD -1
OHu23927C Homo sapiens AT rich interactive domain 1A (SWI-like) (ARID1A), transcript variant 2, mRNA. Customized vector On-demand TBD -1

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_139135.2, 117968462
Length 6207 bp
Structure linear
Update Date 11-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens AT rich interactive domain 1A (SWI-like) (ARID1A), transcript variant 2, mRNA.
Product AT-rich interactive domain-containing protein 1A isoform b
Comment

Summary: This gene encodes a member of the SWI/SNF family, whose members have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. It possesses at least two conserved domains that could be important for its function. First, it has a DNA-binding domain that can specifically bind an AT-rich DNA sequence known to be recognized by a SNF/SWI complex at the beta-globin locus. Second, the C-terminus of the protein can stimulate glucocorticoid receptor-dependent transcriptional activation. It is thought that the protein encoded by this gene confers specificity to the SNF/SWI complex and may recruit the complex to its targets through either protein-DNA or protein-protein interactions. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (2) lacks a segment in the coding region compared to variant 1. Variant 2 encodes isoform b, which lacks an internal segment compared to isoform a.

RefSeq NP_624361.1
CDS 374..6580
Misc Feature(1)134..136
Misc Feature(2)134..136
Misc Feature(3)1460..1462
Misc Feature(4)1460..1462
Misc Feature(5)2183..2185
Misc Feature(6)<2336..>2707
Misc Feature(7)2465..2467
Misc Feature(8)2687..2689
Misc Feature(9)3413..3685
Misc Feature(10)4985..4987
Misc Feature(11)5645..6415
Exon (1)1..1510
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (2)1511..1723
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (3)1724..2176
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (4)2177..2293
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (5)2294..2534
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (6)2535..2624
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (7)2625..2792
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (8)2793..3105
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (9)3106..3251
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (10)3252..3361
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (11)3362..3571
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (12)3572..3779
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (13)3780..3912
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (14)3913..4088
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (15)4089..4239
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (16)4240..4377
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (17)4378..4474
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (18)4475..4715
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (19)4716..4846
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (20)4847..7934
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Translation MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEG PAVGPPQPLGKELQDGAESNGGGGGGGAGSGGGPGAEPDLKNSNGNAGPRPALNNNLTEP PGGGGGGSSDGVGAPPHSAAAALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPG LAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPAPAYALSSPRGGTPG SGAAAAAGSKPPPSSSASASSSSSSFAQQRFGAMGGGGPSAAGGGTPQPTATPTLNQLLT SPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAASGGAQQRSHHA PMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQ PYGSQTPQRYPMTMQGRAQSAMGGLSYTQQIPPYGQQGPSGYGQQGQTPYYNQQSPHPQQ QQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQST TQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPP QELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQSRPSSLPDLSGSIDDLPMGTEGALSPG VSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVP GNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQ IHTGMGSYQQNSMGSYGPQGGQYGPQGGYPRQPNYNALPNANYPSAGMAGGINPMGAGGQ MHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVA MHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAG MAASPEMMGLGDVKLTPATKMNNKADGTPKTESKSKKSSSSTTTNEKITKLYELGGEPER KMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNL NVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGS MQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFNDGSDSTFQ KRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPY SRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYS PSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQVSSPAPLPRPMEN RTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRR RLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQLPGLLELLV EYFRRCLIEIFGILKEYEVGDPGQRTLLDPGRFSKVSSPAPMEGGEEEEELLGPKLEEEE EEEVVENDEEIAFSGKDKPASENSEEKLISKFDKLPVKIVQKNDPFVVDCSDKLGRVQEF DSGLLHWRIGGGDTTEHIQTHFESKTELLPSRPHAPCPPAPRKHVTTAEGTPGTTDQEGP PPDGPPEKRITATMDDMLSTRSSTLTEDGAKSSEAIKESSKFPFGISPAQSHRNIKILED EPHSKDETPLCTLLDWQDSLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILL HHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYP ESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILA TPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLG FLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESR LLDISVSPLMNSLVSQVICDVLFLIGQS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
148+c, tdbSNP:78038864
409+c, tdbSNP:112262001
739+c, tdbSNP:368937545
999..1000+, cdbSNP:376798653
1495+c, gdbSNP:111256946
1548+dbSNP:
1548+a, cdbSNP:199906671
1561+c, tdbSNP:61749356
1562+a, gdbSNP:199828681
1579+a, gdbSNP:374460995
complement(1582)-c, adbSNP:3195240
1597+a, gdbSNP:139540163
1609+a, gdbSNP:200453229
1639+c, tdbSNP:144272459
1654+a, gdbSNP:139562988
complement(1673)-t, cdbSNP:1133451
1702+c, tdbSNP:369923774
1780+dbSNP:
1780+a, gdbSNP:377016928
1884+c, tdbSNP:368949162
1885+a, cdbSNP:61749357
1894..1895+, cdbSNP:370698486
1902+a, cdbSNP:200920292
1920+c, tdbSNP:374096493
1933+a, gdbSNP:200277813
1954..1955+, tdbSNP:35170002
1966+a, gdbSNP:200806701
1970+c, tdbSNP:200572766
1993+a, gdbSNP:375652787
2089+a, gdbSNP:147554664
2106+c, tdbSNP:368655469
2111+a, cdbSNP:202072242
2137+a, gdbSNP:372078591
2164+c, tdbSNP:375210036
2173+a, gdbSNP:369425182
2240+dbSNP:
2240+g, tdbSNP:267598525
2440+dbSNP:
2440+c, gdbSNP:150235028
2447+a, gdbSNP:146402512
2463+c, tdbSNP:370916036
2472+c, tdbSNP:113952845
2482+c, tdbSNP:200927747
2496+a, cdbSNP:367889013
2524+g, tdbSNP:142810143
2553+dbSNP:
2553+a, gdbSNP:376482571
2572+a, gdbSNP:148730647
2577+a, gdbSNP:142353005
2594+a, gdbSNP:139157793
2691+dbSNP:
2691+c, tdbSNP:373690941
2698+a, gdbSNP:144153227
2720+a, gdbSNP:200930418
2731+c, tdbSNP:148841858
2750+a, tdbSNP:372272181
2766+c, tdbSNP:140683722
2806+dbSNP:
2806+a, gdbSNP:145892648
2838+a, gdbSNP:146047233
2869+a, gdbSNP:368766934
2884+c, tdbSNP:149369381
2889+g, tdbSNP:374582065
2914+a, cdbSNP:151274586
2933+c, gdbSNP:369710133
2953+c, tdbSNP:201164050
2956+c, tdbSNP:377256961
2967+a, gdbSNP:145267016
2988+c, tdbSNP:140568310
2994+a, gdbSNP:140123561
3019+c, gdbSNP:149901342
3041+a, gdbSNP:140664170
3071+a, g, tdbSNP:138418893
3091+c, gdbSNP:201864573
3123+dbSNP:
3123+a, gdbSNP:143404119
3125+a, gdbSNP:141432631
3131+c, tdbSNP:387906845
3172+g, tdbSNP:374337987
3177+a, gdbSNP:372040423
3254+dbSNP:
3254+a, cdbSNP:201899604
3309+c, tdbSNP:143919216
3334+g, tdbSNP:374299130
3344+a, tdbSNP:151015091
3419+dbSNP:
3419+a, gdbSNP:182858322
3449+c, tdbSNP:367844043
3454+c, tdbSNP:200853803
3457+a, gdbSNP:147183988
3482+c, gdbSNP:144496027
3532+c, tdbSNP:187798522
3538+c, tdbSNP:200354003
3604+dbSNP:
3604+a, gdbSNP:369726023
3609+a, gdbSNP:372945891
3615+a, gdbSNP:148400981
3730+a, gdbSNP:111262971
3741+c, gdbSNP:369681127
3780+dbSNP:
3780+c, tdbSNP:375417370
3781+a, gdbSNP:146598030
3784+a, tdbSNP:201667981
3871+a, gdbSNP:150266756
3890+a, tdbSNP:200341895
3897+c, tdbSNP:145886877
3908+a, gdbSNP:368010786
3919+dbSNP:
3919+c, tdbSNP:138311127
3942+c, gdbSNP:367585776
3998+c, tdbSNP:146611677
4050+a, gdbSNP:200814245
4065+a, tdbSNP:372401403
4075+c, tdbSNP:376672377
4133+dbSNP:
4133+a, gdbSNP:139907456
4135+c, tdbSNP:138814830
4138+a, gdbSNP:150797909
4148+c, tdbSNP:149538231
4153+c, tdbSNP:139823523
4158+a, gdbSNP:140125151
4165+c, tdbSNP:142429183
4191+c, tdbSNP:150488570
4200+a, gdbSNP:369087151
4228+c, tdbSNP:199673862
4246+dbSNP:
4246+g, tdbSNP:201904230
4253+a, gdbSNP:370983765
4282+a, gdbSNP:139187791
4311+a, gdbSNP:143530554
4318+c, tdbSNP:375663064
4345+c, tdbSNP:377622327
4348+c, g, tdbSNP:148038965
4351..4353+, gcadbSNP:374564889
4351+a, gdbSNP:370696498
4376+c, tdbSNP:387906846
4380+dbSNP:
4380+a, gdbSNP:139805332
4381+c, tdbSNP:368865620
4398+a, cdbSNP:200739025
4426+c, tdbSNP:200122106
4435+c, tdbSNP:199846866
4438..4439+, cdbSNP:35425835
4451+a, gdbSNP:375202405
4490+dbSNP:
4490+c, tdbSNP:370907880
4499+c, tdbSNP:201556442
4501+g, tdbSNP:140978841
4536+c, tdbSNP:375431469
4588+c, gdbSNP:144944633
4591+a, gdbSNP:148936933
4601+c, gdbSNP:151074395
4616+c, tdbSNP:372335126
4669+a, gdbSNP:201700725
4677+c, tdbSNP:376792436
4696+a, gdbSNP:144728575
4723+dbSNP:
4723+a, gdbSNP:116540923
4798+c, tdbSNP:149468118
4812+a, tdbSNP:375761808
4830+c, gdbSNP:370142648
4836+a, gdbSNP:61756316
4841+a, gdbSNP:11550593
4958+dbSNP:
4958+c, gdbSNP:368675329
4968+a, gdbSNP:370901533
4969+g, tdbSNP:200936451
4988+c, tdbSNP:142755921
4994+c, tdbSNP:372045959
5033+c, tdbSNP:187631645
5056+a, gdbSNP:375160070
5058+a, gdbSNP:140946580
5107+c, gdbSNP:200221564
5130+a, gdbSNP:112408351
5171+a, gdbSNP:375250508
5179+a, gdbSNP:12126391
5213+c, gdbSNP:150534917
5219+c, tdbSNP:372213935
5220+a, gdbSNP:375198223
5264+c, gdbSNP:140055856
5299+c, tdbSNP:140358624
5328+a, gdbSNP:367835531
5337+c, tdbSNP:191813608
5340+c, tdbSNP:143597306
5350+a, gdbSNP:138605055
5351+c, gdbSNP:182301865
5357+c, tdbSNP:369894428
5358+a, gdbSNP:371595717
5364+a, gdbSNP:376401187
5369+a, tdbSNP:150076443
5388+c, tdbSNP:369924806
5392..5393+, gdbSNP:35869962
5401+c, gdbSNP:186671944
5437+a, gdbSNP:373330957
5439+a, c, gdbSNP:41303631
5441+a, tdbSNP:139230162
complement(5442)-t, cdbSNP:75589449
complement(5444)-c, adbSNP:75329807
5472+c, tdbSNP:376577707
5475+a, gdbSNP:369532498
5492+a, gdbSNP:375952330
5501+c, gdbSNP:143257313
5618+c, tdbSNP:370333544
5633+c, tdbSNP:372543523
5666+a, gdbSNP:201604768
5679+a, gdbSNP:201064943
5734+c, gdbSNP:375639155
5770+a, gdbSNP:150606081
5801+c, gdbSNP:149293353
5815+c, tdbSNP:374525953
5911+a, gdbSNP:370784034
5926+a, gdbSNP:146829093
5953+a, cdbSNP:373094718
5968+a, gdbSNP:149918240
5974+c, gdbSNP:145004598
5980+c, tdbSNP:182795900
6022+a, gdbSNP:368014828
6038+a, cdbSNP:150055041
6085+c, tdbSNP:147766570
6154+a, gdbSNP:371860024
6166+c, tdbSNP:200129774
6171+c, gdbSNP:146955423
6195+a, gdbSNP:142069738
6200+a, gdbSNP:201998747
6304+c, tdbSNP:138280531
6308+c, tdbSNP:149633292
6335+a, gdbSNP:141992367
6379+g, tdbSNP:200298922
6381+a, gdbSNP:139576809
6417+a, gdbSNP:142878055
6452+g, tdbSNP:372878743
6484+c, tdbSNP:139585602
6507+c, tdbSNP:375849292
6529+a, gdbSNP:141124050
6531+c, tdbSNP:369917594
6577+a, gdbSNP:200394526
6585+c, tdbSNP:201289176
6590+g, tdbSNP:372029026
6597..6598+, cdbSNP:369896037
6597+c, tdbSNP:377238538
6601+c, tdbSNP:377624643
6603+a, cdbSNP:200568725
6605..6606+, cdbSNP:3841356
6605+c, tdbSNP:201547182
6606+a, gdbSNP:199555039
6617+c, gdbSNP:375168652
6618+a, gdbSNP:114615474
6666+c, tdbSNP:193200602
6731..6732+, tcdbSNP:201874010
6749+c, tdbSNP:185013013
6792+c, tdbSNP:377690379
6818+c, tdbSNP:190650562
6860..6861+, ttdbSNP:373050734
6867+a, tdbSNP:1044113
6914..6915+, adbSNP:369865650
6950+c, tdbSNP:144625506
6983..6984+, aadbSNP:71582803
6983+, tdbSNP:140784604
7001..7002+, aadbSNP:71007893
7002+, tdbSNP:140247425
7004+g, tdbSNP:201576837
7028+a, gdbSNP:192390664
7034+a, gdbSNP:139737956
7145+a, gdbSNP:183673478
complement(7190)-t, adbSNP:145352087
7472+a, tdbSNP:60798877
7578+c, tdbSNP:12685
7605+a, cdbSNP:188298594
7665..7666+, adbSNP:36117735
7780+a, gdbSNP:147234817
7848+a, tdbSNP:180769241
7858+g, tdbSNP:77103907
Gene SymbolARID1A
Gene SynonymB120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Chromosome1
Locus Map1p35.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_139135 Homo sapiens AT rich interactive domain 1A (SWI-like) (ARID1A), transcript variant 2, mRNA. On-demand TBD TBD
NM_139135 Homo sapiens AT rich interactive domain 1A (SWI-like) (ARID1A), transcript variant 2, mRNA. On-demand TBD TBD
Title Mutations in linker histone genes HIST1H1 B, C, D, and E; OCT2 (POU2F2); IRF8; and ARID1A underlying the pathogenesis of follicular lymphoma .
Author Li H, Kaminski MS, Li Y, Yildiz M, Ouillette P, Jones S, Fox H, Jacobi K, Saiya-Cork K, Bixby D, Lebovic D, Roulston D, Shedden K, Sabel M, Marentette L, Cimmino V, Chang AE and Malek SN.
Journal Blood 123 (10), 1487-1498 (2014)
Title ARID1B is a specific vulnerability in ARID1A-mutant cancers .
Author Helming KC, Wang X, Wilson BG, Vazquez F, Haswell JR, Manchester HE, Kim Y, Kryukov GV, Ghandi M, Aguirre AJ, Jagani Z, Wang Z, Garraway LA, Hahn WC and Roberts CW.
Journal Nat. Med. 20 (3), 251-254 (2014)
Title High prevalence of MAP2K1 mutations in variant and IGHV4-34-expressing hairy-cell leukemias .
Author Waterfall JJ, Arons E, Walker RL, Pineda M, Roth L, Killian JK, Abaan OD, Davis SR, Kreitman RJ and Meltzer PS.
Journal Nat. Genet. 46 (1), 8-10 (2014)
Title Exome sequencing identifies frequent inactivating mutations in BAP1, ARID1A and PBRM1 in intrahepatic cholangiocarcinomas .
Author Jiao Y, Pawlik TM, Anders RA, Selaru FM, Streppel MM, Lucas DJ, Niknafs N, Guthrie VB, Maitra A, Argani P, Offerhaus GJ, Roa JC, Roberts LR, Gores GJ, Popescu I, Alexandrescu ST, Dima S, Fassan M, Simbolo M, Mafficini A, Capelli P, Lawlor RT, Ruzzenente A, Guglielmi A, Tortora G, de Braud F, Scarpa A, Jarnagin W, Klimstra D, Karchin R, Velculescu VE, Hruban RH, Vogelstein B, Kinzler KW, Papadopoulos N and Wood LD.
Journal Nat. Genet. 45 (12), 1470-1473 (2013)
Title Loss of ARID1A expression correlates with stages of tumor progression in uterine endometrioid carcinoma .
Author Mao TL, Ardighieri L, Ayhan A, Kuo KT, Wu CH, Wang TL and Shih IeM.
Journal Am. J. Surg. Pathol. 37 (9), 1342-1348 (2013)
Title p300/CREB binding protein-related protein p270 is a component of mammalian SWI/SNF complexes .
Author Dallas PB, Cheney IW, Liao DW, Bowrin V, Byam W, Pacchione S, Kobayashi R, Yaciuk P and Moran E.
Journal Mol. Cell. Biol. 18 (6), 3596-3603 (1998)
Title Molecular cloning and expression of a novel human cDNA containing .
Author Takeuchi T, Chen BK, Qiu Y, Sonobe H and Ohtsuki Y.
Journal Gene 204 (1-2), 71-77 (1997)
Title Purification and biochemical heterogeneity of the mammalian SWI-SNF complex .
Author Wang W, Cote J, Xue Y, Zhou S, Khavari PA, Biggar SR, Muchardt C, Kalpana GV, Goff SP, Yaniv M, Workman JL and Crabtree GR.
Journal EMBO J. 15 (19), 5370-5382 (1996)
Title Diversity and specialization of mammalian SWI/SNF complexes .
Author Wang W, Xue Y, Zhou S, Kuo A, Cairns BR and Crabtree GR.
Journal Genes Dev. 10 (17), 2117-2130 (1996)
Title Coffin-Siris Syndrome .
Author Schrier Vergano,S., Santen,G., Wieczorek,D., Wollnik,B., Matsumoto,N. and Deardorff,M.A.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.