• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens AT rich interactive domain 1A (SWI-like) (ARID1A), transcript variant 2, mRNA.


RefSeq Accession Definition Services Price Order
NM_139135 Homo sapiens AT rich interactive domain 1A (SWI-like) (ARID1A), transcript variant 2, mRNA. ORF Sequence $2793.15
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_139135.2, 117968462
Length 7934 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens AT rich interactive domain 1A (SWI-like) (ARID1A), transcript variant 2, mRNA.
Product AT-rich interactive domain-containing protein 1A isoform b
Comment

Summary: This gene encodes a member of the SWI/SNF family, whose members have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. It possesses at least two conserved domains that could be important for its function. First, it has a DNA-binding domain that can specifically bind an AT-rich DNA sequence known to be recognized by a SNF/SWI complex at the beta-globin locus. Second, the C-terminus of the protein can stimulate glucocorticoid receptor-dependent transcriptional activation. It is thought that the protein encoded by this gene confers specificity to the SNF/SWI complex and may recruit the complex to its targets through either protein-DNA or protein-protein interactions. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (2) lacks a segment in the coding region compared to variant 1. Variant 2 encodes isoform b, which lacks an internal segment compared to isoform a.

RefSeq NP_624361.1
CDS 374..6580
Misc Feature(1)134..136
Misc Feature(2)134..136
Misc Feature(3)1460..1462
Misc Feature(4)1460..1462
Misc Feature(5)2183..2185
Misc Feature(6)2465..2467
Misc Feature(7)2687..2689
Misc Feature(8)3422..3685
Misc Feature(9)4985..4987
Misc Feature(10)5645..6415
Exon (1)1..1510
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (2)1511..1723
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (3)1724..2176
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (4)2177..2293
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (5)2294..2534
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (6)2535..2624
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (7)2625..2792
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (8)2793..3105
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (9)3106..3251
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (10)3252..3361
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (11)3362..3571
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (12)3572..3779
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (13)3780..3912
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (14)3913..4088
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (15)4089..4239
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (16)4240..4377
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (17)4378..4474
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (18)4475..4715
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (19)4716..4846
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Exon (20)4847..7934
Gene:ARID1A
Gene Synonym:B120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Translation MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEG PAVGPPQPLGKELQDGAESNGGGGGGGAGSGGGPGAEPDLKNSNGNAGPRPALNNNLTEP PGGGGGGSSDGVGAPPHSAAAALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPG LAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPAPAYALSSPRGGTPG SGAAAAAGSKPPPSSSASASSSSSSFAQQRFGAMGGGGPSAAGGGTPQPTATPTLNQLLT SPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAASGGAQQRSHHA PMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQ PYGSQTPQRYPMTMQGRAQSAMGGLSYTQQIPPYGQQGPSGYGQQGQTPYYNQQSPHPQQ QQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQST TQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPP QELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQSRPSSLPDLSGSIDDLPMGTEGALSPG VSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVP GNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQ IHTGMGSYQQNSMGSYGPQGGQYGPQGGYPRQPNYNALPNANYPSAGMAGGINPMGAGGQ MHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVA MHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAG MAASPEMMGLGDVKLTPATKMNNKADGTPKTESKSKKSSSSTTTNEKITKLYELGGEPER KMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNL NVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGS MQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFNDGSDSTFQ KRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPY SRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYS PSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQVSSPAPLPRPMEN RTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRR RLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQLPGLLELLV EYFRRCLIEIFGILKEYEVGDPGQRTLLDPGRFSKVSSPAPMEGGEEEEELLGPKLEEEE EEEVVENDEEIAFSGKDKPASENSEEKLISKFDKLPVKIVQKNDPFVVDCSDKLGRVQEF DSGLLHWRIGGGDTTEHIQTHFESKTELLPSRPHAPCPPAPRKHVTTAEGTPGTTDQEGP PPDGPPEKRITATMDDMLSTRSSTLTEDGAKSSEAIKESSKFPFGISPAQSHRNIKILED EPHSKDETPLCTLLDWQDSLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILL HHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYP ESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILA TPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLG FLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESR LLDISVSPLMNSLVSQVICDVLFLIGQS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
148+c, tdbSNP:78038864
409+c, tdbSNP:112262001
1495+c, gdbSNP:111256946
1548+dbSNP:
1548+a, cdbSNP:199906671
1561+c, tdbSNP:61749356
1562+a, gdbSNP:199828681
1582+a, cdbSNP:3195240
1597+a, gdbSNP:139540163
1609+a, gdbSNP:200453229
1639+c, tdbSNP:144272459
1654+a, gdbSNP:139562988
1673+c, tdbSNP:1133451
1885+dbSNP:
1885+a, cdbSNP:61749357
1902+a, cdbSNP:200920292
1933+a, gdbSNP:200277813
1954..1955+, tdbSNP:35170002
1966+a, gdbSNP:200806701
1970+c, tdbSNP:200572766
1976+a, cdbSNP:145565346
2089+a, gdbSNP:147554664
2111+a, cdbSNP:202072242
2213+dbSNP:
2213+g, tdbSNP:141987711
2324+dbSNP:
2324+a, cdbSNP:148232580
2440+c, gdbSNP:150235028
2447+a, gdbSNP:146402512
2472+c, tdbSNP:113952845
2482+c, tdbSNP:200927747
2524+g, tdbSNP:142810143
2572+dbSNP:
2572+a, gdbSNP:148730647
2577+a, gdbSNP:142353005
2594+a, gdbSNP:139157793
2663+dbSNP:
2663+a, tdbSNP:147650363
2698+a, gdbSNP:144153227
2720+a, gdbSNP:200930418
2731+c, tdbSNP:148841858
2766+c, tdbSNP:140683722
2806+dbSNP:
2806+a, gdbSNP:145892648
2838+a, gdbSNP:146047233
2884+c, tdbSNP:149369381
2914+a, cdbSNP:151274586
2953+c, tdbSNP:201164050
2967+a, gdbSNP:145267016
2988+c, tdbSNP:140568310
2994+a, gdbSNP:140123561
3019+c, gdbSNP:149901342
3041+a, gdbSNP:140664170
3071+a, g, tdbSNP:138418893
3091+c, gdbSNP:201864573
3123+dbSNP:
3123+a, gdbSNP:143404119
3125+a, gdbSNP:141432631
3254+dbSNP:
3254+a, cdbSNP:201899604
3309+c, tdbSNP:143919216
3344+a, tdbSNP:151015091
3419+dbSNP:
3419+a, gdbSNP:182858322
3454+c, tdbSNP:200853803
3457+a, gdbSNP:147183988
3482+c, gdbSNP:144496027
3532+c, tdbSNP:187798522
3538+c, tdbSNP:200354003
3615+dbSNP:
3615+a, gdbSNP:148400981
3730+a, gdbSNP:111262971
3781+dbSNP:
3781+a, gdbSNP:146598030
3784+a, tdbSNP:201667981
3871+a, gdbSNP:150266756
3890+a, tdbSNP:200341895
3897+c, tdbSNP:145886877
3919+dbSNP:
3919+c, tdbSNP:138311127
3998+c, tdbSNP:146611677
4050+a, gdbSNP:200814245
4133+dbSNP:
4133+a, gdbSNP:139907456
4135+c, tdbSNP:138814830
4138+a, gdbSNP:150797909
4148+c, tdbSNP:149538231
4153+c, tdbSNP:139823523
4158+a, gdbSNP:140125151
4165+c, tdbSNP:142429183
4191+c, tdbSNP:150488570
4221+a, gdbSNP:142363094
4228+c, tdbSNP:199673862
4246+dbSNP:
4246+g, tdbSNP:201904230
4282+a, gdbSNP:139187791
4311+a, gdbSNP:143530554
4348+c, g, tdbSNP:148038965
4380+dbSNP:
4380+a, gdbSNP:139805332
4398+a, cdbSNP:200739025
4426+c, tdbSNP:200122106
4435..4436+, cdbSNP:35425835
4435+c, tdbSNP:199846866
4499+dbSNP:
4499+c, tdbSNP:201556442
4501+g, tdbSNP:140978841
4588+c, gdbSNP:144944633
4591+a, gdbSNP:148936933
4601+c, gdbSNP:151074395
4669+a, gdbSNP:201700725
4696+a, gdbSNP:144728575
4723+dbSNP:
4723+a, gdbSNP:116540923
4798+c, tdbSNP:149468118
4836+a, gdbSNP:61756316
4841+a, gdbSNP:11550593
4969+dbSNP:
4969+g, tdbSNP:200936451
4988+c, tdbSNP:142755921
5033+c, tdbSNP:187631645
5058+a, gdbSNP:140946580
5107+c, gdbSNP:200221564
5130+a, gdbSNP:112408351
5140+c, gdbSNP:139250075
5179+a, gdbSNP:12126391
5213+c, gdbSNP:150534917
5264+c, gdbSNP:140055856
5299+c, tdbSNP:140358624
5337+c, tdbSNP:191813608
5340+c, tdbSNP:143597306
5350+a, gdbSNP:138605055
5351+c, gdbSNP:182301865
5369+a, tdbSNP:150076443
5390..5391+, gdbSNP:35869962
5401+c, gdbSNP:186671944
5439+a, c, gdbSNP:41303631
5441+a, tdbSNP:139230162
5442+c, tdbSNP:75589449
5444+a, cdbSNP:75329807
5501+c, gdbSNP:143257313
5516+g, tdbSNP:148574023
5666+a, gdbSNP:201604768
5679+a, gdbSNP:201064943
5770+a, gdbSNP:150606081
5801+c, gdbSNP:149293353
5926+a, gdbSNP:146829093
5968+a, gdbSNP:149918240
5974+c, gdbSNP:145004598
5980+c, tdbSNP:182795900
6038+a, cdbSNP:150055041
6085+c, tdbSNP:147766570
6166+c, tdbSNP:200129774
6171+c, gdbSNP:146955423
6195+a, gdbSNP:142069738
6200+a, gdbSNP:201998747
6304+c, tdbSNP:138280531
6308+c, tdbSNP:149633292
6335+a, gdbSNP:141992367
6379+g, tdbSNP:200298922
6381+a, gdbSNP:139576809
6417+a, gdbSNP:142878055
6484+c, tdbSNP:139585602
6529+a, gdbSNP:141124050
6577+a, gdbSNP:200394526
6585+c, tdbSNP:201289176
6597..6598+, cdbSNP:3841356
6603+a, cdbSNP:200568725
6605+c, tdbSNP:201547182
6606+a, gdbSNP:199555039
6618+a, gdbSNP:114615474
6666+c, tdbSNP:193200602
6731..6732+, tcdbSNP:201874010
6749+c, tdbSNP:185013013
6818+c, tdbSNP:190650562
6867+a, tdbSNP:1044113
6950+c, tdbSNP:144625506
6983..6984+, aadbSNP:71582803
6983+, tdbSNP:140784604
6984..6985+, aadbSNP:71007893
7002+, tdbSNP:140247425
7004+g, tdbSNP:201576837
7028+a, gdbSNP:192390664
7034+a, gdbSNP:139737956
7145+a, gdbSNP:183673478
7190+a, tdbSNP:145352087
7472+a, tdbSNP:60798877
7578+c, tdbSNP:12685
7605+a, cdbSNP:188298594
7665..7666+, adbSNP:36117735
7780+a, gdbSNP:147234817
7848+a, tdbSNP:180769241
7858+g, tdbSNP:77103907
Gene SymbolARID1A
Gene SynonymB120; BAF250; BAF250a; BM029; C1orf4; ELD; hELD; hOSA1; MRD14; OSA1; P270; SMARCF1
Chromosome1
Locus Map1p35.3
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_006015 Homo sapiens AT rich interactive domain 1A (SWI-like) (ARID1A), transcript variant 1, mRNA. Full Length Quote
ORF Sequence $3086.10
NM_139135 Homo sapiens AT rich interactive domain 1A (SWI-like) (ARID1A), transcript variant 2, mRNA. Full Length $3570.30
ORF Sequence $2793.15
Title Integrated genomic analyses identify ARID1A and ARID1B alterations in the childhood cancer neuroblastoma .
Author Sausen,M., Leary,R.J., Jones,S., Wu,J., Reynolds,C.P., Liu,X., Blackford,A., Parmigiani,G., Diaz,L.A. Jr., Papadopoulos,N., Vogelstein,B., Kinzler,K.W., Velculescu,V.E. and Hogarty,M.D.
Journal Nat. Genet. 45 (1), 12-17 (2013)
Title Clinicopathologic analysis of loss of AT-rich interactive domain 1A expression in endometrial cancer .
Author Rahman,M., Nakayama,K., Rahman,M.T., Katagiri,H., Katagiri,A., Ishibashi,T., Ishikawa,M., Iida,K. and Miyazaki,K.
Journal Hum. Pathol. 44 (1), 103-109 (2013)
Title Loss of ARID1A expression is uncommon in gastric, colorectal, and prostate cancers .
Author Kim,M.S., Je,E.M., Yoo,N.J. and Lee,S.H.
Journal APMIS 120 (12), 1020-1022 (2012)
Title Loss of ARID1A expression is an early molecular event in tumor progression from ovarian endometriotic cyst to clear cell and endometrioid carcinoma .
Author Ayhan,A., Mao,T.L., Seckin,T., Wu,C.H., Guan,B., Ogawa,H., Futagami,M., Mizukami,H., Yokoyama,Y., Kurman,R.J. and Shih,Ie.M.
Journal Int. J. Gynecol. Cancer 22 (8), 1310-1315 (2012)
Title ARID1A expression loss in gastric cancer: pathway-dependent roles with and without Epstein-Barr virus infection and microsatellite instability .
Author Abe,H., Maeda,D., Hino,R., Otake,Y., Isogai,M., Ushiku,A.S., Matsusaka,K., Kunita,A., Ushiku,T., Uozaki,H., Tateishi,Y., Hishima,T., Iwasaki,Y., Ishikawa,S. and Fukayama,M.
Journal Virchows Arch. 461 (4), 367-377 (2012)
Title Chromosomal mapping and expression of the human B120 gene .
Author Takeuchi,T., Furihata,M., Heng,H.H., Sonobe,H. and Ohtsuki,Y.
Journal Gene 213 (1-2), 189-193 (1998)
Title p300/CREB binding protein-related protein p270 is a component of mammalian SWI/SNF complexes .
Author Dallas,P.B., Cheney,I.W., Liao,D.W., Bowrin,V., Byam,W., Pacchione,S., Kobayashi,R., Yaciuk,P. and Moran,E.
Journal Mol. Cell. Biol. 18 (6), 3596-3603 (1998)
Title Molecular cloning and expression of a novel human cDNA containing .
Author Takeuchi,T., Chen,B.K., Qiu,Y., Sonobe,H. and Ohtsuki,Y.
Journal Gene 204 (1-2), 71-77 (1997)
Title Purification and biochemical heterogeneity of the mammalian SWI-SNF complex .
Author Wang,W., Cote,J., Xue,Y., Zhou,S., Khavari,P.A., Biggar,S.R., Muchardt,C., Kalpana,G.V., Goff,S.P., Yaniv,M., Workman,J.L. and Crabtree,G.R.
Journal EMBO J. 15 (19), 5370-5382 (1996)
Title Diversity and specialization of mammalian SWI/SNF complexes .
Author Wang,W., Xue,Y., Zhou,S., Kuo,A., Cairns,B.R. and Crabtree,G.R.
Journal Genes Dev. 10 (17), 2117-2130 (1996)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878