• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens lipase, member H (LIPH), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu18934 Homo sapiens lipase, member H (LIPH), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu18934C Homo sapiens lipase, member H (LIPH), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_139248.2, 62241034
Length 1356 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens lipase, member H (LIPH), mRNA.
Product lipase member H precursor
Comment

Summary: This gene encodes a membrane-bound member of the mammalian triglyceride lipase family. It catalyzes the production of 2-acyl lysophosphatidic acid (LPA), which is a lipid mediator with diverse biological properties that include platelet aggregation, smooth muscle contraction, and stimulation of cell proliferation and motility. [provided by RefSeq, Jul 2008].

RefSeq NP_640341.1
CDS 111..1466
Misc Feature(1)66..68
Misc Feature(2)225..1019
Misc Feature(3)564..578
Misc Feature(4)order(570..572,642..644,852..854)
Misc Feature(5)order(807..812,843..848)
Exon (1)1..159
Gene:LIPH
Gene Synonym:AH; ARWH2; LAH2; LPDLR; mPA-PLA1; PLA1B
Exon (2)160..527
Gene:LIPH
Gene Synonym:AH; ARWH2; LAH2; LPDLR; mPA-PLA1; PLA1B
Exon (3)528..636
Gene:LIPH
Gene Synonym:AH; ARWH2; LAH2; LPDLR; mPA-PLA1; PLA1B
Exon (4)637..738
Gene:LIPH
Gene Synonym:AH; ARWH2; LAH2; LPDLR; mPA-PLA1; PLA1B
Exon (5)739..828
Gene:LIPH
Gene Synonym:AH; ARWH2; LAH2; LPDLR; mPA-PLA1; PLA1B
Exon (6)829..996
Gene:LIPH
Gene Synonym:AH; ARWH2; LAH2; LPDLR; mPA-PLA1; PLA1B
Exon (7)997..1092
Gene:LIPH
Gene Synonym:AH; ARWH2; LAH2; LPDLR; mPA-PLA1; PLA1B
Exon (8)1093..1204
Gene:LIPH
Gene Synonym:AH; ARWH2; LAH2; LPDLR; mPA-PLA1; PLA1B
Exon (9)1205..1378
Gene:LIPH
Gene Synonym:AH; ARWH2; LAH2; LPDLR; mPA-PLA1; PLA1B
Exon (10)1379..2474
Gene:LIPH
Gene Synonym:AH; ARWH2; LAH2; LPDLR; mPA-PLA1; PLA1B
Translation MLRFYLFISLLCLSRSDAEETCPSFTRLSFHSAVVGTGLNVRLMLYTRKNLTCAQTINSS AFGNLNVTKKTTFIVHGFRPTGSPPVWMDDLVKGLLSVEDMNVVVVDWNRGATTLIYTHA SSKTRKVAMVLKEFIDQMLAEGASLDDIYMIGVSLGAHISGFVGEMYDGWLGRITGLDPA GPLFNGKPHQDRLDPSDAQFVDVIHSDTDALGYKEPLGNIDFYPNGGLDQPGCPKTILGG FQYFKCDHQRSVYLYLSSLRESCTITAYPCDSYQDYRNGKCVSCGTSQKESCPLLGYYAD NWKDHLRGKDPPMTKAFFDTAEESPFCMYHYFVDIITWNKNVRRGDITIKLRDKAGNTTE SKINHEPTTFQKYHQVSLLARFNQDLDKVAAISLMFSTGSLIGPRYKLRILRMKLRSLAH PERPQLCRYDLVLMENVETVFQPILCPELQL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(56)-dbSNP:
complement(56)-g, adbSNP:113557528
complement(56)-g, adbSNP:386444429
complement(62)-t, cdbSNP:370493080
complement(77)-t, adbSNP:201793169
complement(80)-g, cdbSNP:200259598
complement(98)-g, adbSNP:145856126
complement(109)-t, gdbSNP:374640229
complement(118)-t, cdbSNP:149948165
complement(122)-g, cdbSNP:368798948
complement(161)-dbSNP:
complement(161)-g, adbSNP:139264479
complement(162)-t, cdbSNP:374807100
complement(220)-g, adbSNP:371942576
complement(231)-t, cdbSNP:61749467
complement(269)-g, adbSNP:61741645
complement(279)-t, cdbSNP:368989054
complement(308)-g, adbSNP:202071682
complement(346)-t, cdbSNP:150941910
complement(353)-t, adbSNP:367651367
complement(357)-t, adbSNP:201629647
complement(368)-g, adbSNP:201236456
complement(416)-g, adbSNP:141937955
complement(417)-t, cdbSNP:373730693
complement(419)-t, adbSNP:201500499
432+c, tdbSNP:267607219
complement(439)-t, cdbSNP:370653261
complement(449)-t, cdbSNP:201972319
complement(451)-g, adbSNP:199508534
complement(461)-g, adbSNP:200623809
complement(471)-g, adbSNP:201061198
complement(509)-t, adbSNP:368077903
complement(518)-t, gdbSNP:200839025
complement(519)-g, adbSNP:370951431
complement(520)-t, cdbSNP:199726918
complement(612)-dbSNP:
complement(612)-t, cdbSNP:371388993
complement(649)-dbSNP:
complement(649)-g, cdbSNP:138900382
complement(717)-t, cdbSNP:372971860
complement(737)-g, adbSNP:367726629
complement(760)-dbSNP:
complement(760)-g, adbSNP:369104457
complement(777)-g, adbSNP:371437625
complement(793)-c, adbSNP:146089796
complement(846)-dbSNP:
complement(846)-t, adbSNP:201249971
complement(852)-t, gdbSNP:201868115
complement(862)-g, adbSNP:141948236
complement(921)-t, cdbSNP:148130104
complement(962)-g, adbSNP:144288709
complement(967)-g, adbSNP:140565721
complement(968)-t, cdbSNP:139327062
complement(973)-t, adbSNP:376974379
complement(980)-g, cdbSNP:145766081
complement(996)-g, cdbSNP:141115870
complement(1005)-dbSNP:
complement(1005)-t, cdbSNP:377047996
complement(1008)-c, adbSNP:187535174
complement(1015)-c, adbSNP:183467748
complement(1022)-g, adbSNP:372786982
complement(1025)-g, adbSNP:370205963
complement(1029)-t, gdbSNP:199928391
complement(1030)-t, cdbSNP:147810274
complement(1051)-g, adbSNP:150268336
complement(1113)-dbSNP:
complement(1113)-t, cdbSNP:140838242
complement(1118)-t, cdbSNP:150976315
complement(1133)-g, adbSNP:142603972
complement(1146)-c, adbSNP:373143467
complement(1200)-t, adbSNP:369971367
complement(1226)-dbSNP:
complement(1226)-t, cdbSNP:61730237
complement(1292)-c, adbSNP:186353353
1295+c, tdbSNP:182644864
complement(1303)-g, adbSNP:145905764
complement(1372)-g, adbSNP:373209531
complement(1392)-dbSNP:
complement(1392)-g, adbSNP:146753303
complement(1403)-g, adbSNP:143637393
complement(1407)-g, adbSNP:371600390
complement(1413)-g, cdbSNP:376062316
complement(1552)-t, cdbSNP:55854644
complement(1565)-g, adbSNP:191380118
complement(1621)-t, cdbSNP:186055959
complement(1648)-g, adbSNP:6788865
complement(1665)-g, adbSNP:373704197
1751+c, tdbSNP:139071142
complement(1838)-t, cdbSNP:369396307
complement(1861)-t, cdbSNP:115973917
complement(1893)-g, cdbSNP:181023264
complement(1917)-t, gdbSNP:146313680
complement(1986)-t, cdbSNP:192205909
complement(2060)-g, adbSNP:146218081
complement(2085)-t, cdbSNP:186138603
complement(2201)-g, adbSNP:373382359
complement(2276)-t, cdbSNP:376480368
2295+a, gdbSNP:1048823
complement(2295)-t, cdbSNP:386513404
2406+a, tdbSNP:141497229
Gene SymbolLIPH
Gene SynonymAH; ARWH2; LAH2; LPDLR; mPA-PLA1; PLA1B
Chromosome3
Locus Map3q27
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_139248 Homo sapiens lipase, member H (LIPH), mRNA. In-stock $99.00 5-7
NM_139248 Homo sapiens lipase, member H (LIPH), mRNA. In-stock $99.00 5-7
NM_139248 Homo sapiens lipase, member H (LIPH), mRNA. In-stock $99.00 5-7
Title Lipase member H is a novel secreted protein selectively upregulated in human lung adenocarcinomas and bronchioloalveolar carcinomas .
Author Seki Y, Yoshida Y, Ishimine H, Shinozaki-Ushiku A, Ito Y, Sumitomo K, Nakajima J, Fukayama M, Michiue T, Asashima M and Kurisaki A.
Journal Biochem. Biophys. Res. Commun. 443 (4), 1141-1147 (2014)
Title Association of hepatic lipase gene polymorphisms with hypertriglyceridemia and low high-density lipoprotein-cholesterol levels among South Indian subjects without diabetes .
Author Ayyappa KA, Ghosh S, Mohan V and Radha V.
Journal Diabetes Technol. Ther. 15 (6), 503-512 (2013)
Title Two cases of autosomal recessive woolly hair with LIPH gene mutations .
Author Harada K, Inozume T, Kawamura T, Shibagaki N, Kinoshita T, Deguchi
Journal Int. J. Dermatol. 52 (5), 572-574 (2013)
Title The beta9 loop domain of PA-PLA1alpha has a crucial role in autosomal recessive woolly hair/hypotrichosis .
Author Shinkuma,S., Inoue,A., Aoki,J., Nishie,W., Natsuga,K., Ujiie,H., Nomura,T., Abe,R., Akiyama,M. and Shimizu,H.
Journal J. Invest. Dermatol. 132 (8), 2093-2095 (2012)
Title A novel mutation in the Lipase H gene underlies autosomal recessive hypotrichosis and woolly hair .
Author Tariq M, Azhar A, Baig SM, Dahl N and Klar J.
Journal Sci Rep 2, 730 (2012)
Title A novel locus for autosomal recessive form of hypotrichosis maps to chromosome 3q26.33-q27.3 .
Author Aslam,M., Chahrour,M.H., Razzaq,A., Haque,S., Yan,K., Leal,S.M. and Ahmad,W.
Journal J. Med. Genet. 41 (11), 849-852 (2004)
Title Biochemical and molecular characterization of two phosphatidic acid-selective phospholipase A1s, mPA-PLA1alpha and mPA-PLA1beta .
Author Hiramatsu T, Sonoda H, Takanezawa Y, Morikawa R, Ishida M, Kasahara K, Sanai Y, Taguchi R, Aoki J and Arai H.
Journal J. Biol. Chem. 278 (49), 49438-49447 (2003)
Title Identification of a novel lipase gene mutated in lpd mice with hypertriglyceridemia and associated with dyslipidemia in humans .
Author Wen XY, Hegele RA, Wang J, Wang DY, Cheung J, Wilson M, Yahyapour M, Bai Y, Zhuang L, Skaug J, Young TK, Connelly PW, Koop BF, Tsui
Journal Hum. Mol. Genet. 12 (10), 1131-1143 (2003)
Title A novel phosphatidic acid-selective phospholipase A1 that produces lysophosphatidic acid .
Author Sonoda H, Aoki J, Hiramatsu T, Ishida M, Bandoh K, Nagai Y, Taguchi R, Inoue K and Arai H.
Journal J. Biol. Chem. 277 (37), 34254-34263 (2002)
Title Lipase H, a new member of the triglyceride lipase family synthesized by the intestine .
Author Jin W, Broedl UC, Monajemi H, Glick JM and Rader DJ.
Journal Genomics 80 (3), 268-273 (2002)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.