• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_139276 Homo sapiens signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $809.00 $760.00 15

*Business Day

Related Services

RefSeq Version NM_139276.2, 47080104
Length 4978 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3), transcript variant 1, mRNA.
Product signal transducer and activator of transcription 3 isoform 1
Comment

Summary: The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. Three alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longest transcript, and encodes the longest isoform (1).

RefSeq NP_644805.1
CDS 241..2553
Misc Feature(1)148..150
Misc Feature(2)218..240
Misc Feature(3)218..240
Misc Feature(4)244..600
Misc Feature(5)244..600
Misc Feature(6)244..246
Misc Feature(7)655..1197
Misc Feature(8)688..726
Misc Feature(9)1201..1962
Misc Feature(10)1900..2385
Misc Feature(11)order(2011..2013,2065..2067,2146..2148,2152..2154)
Misc Feature(12)order(2149..2151,2197..2199)
Misc Feature(13)order(2179..2184,2368..2370)
Misc Feature(14)2209..2211
Misc Feature(15)2260..2262
Misc Feature(16)2293..2295
Misc Feature(17)2293..2295
Misc Feature(18)2311..2313
Misc Feature(19)2353..2355
Misc Feature(20)2353..2355
Misc Feature(21)2353..2355
Misc Feature(22)2353..2355
Misc Feature(23)2353..2355
Misc Feature(24)2353..2355
Misc Feature(25)2353..2355
Misc Feature(26)2353..2355
Misc Feature(27)2353..2355
Misc Feature(28)2419..2421
Misc Feature(29)2419..2421
Misc Feature(30)2419..2421
Misc Feature(31)2419..2421
Misc Feature(32)2419..2421
Misc Feature(33)2419..2421
Misc Feature(34)2419..2421
Exon (1)1..217
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (2)218..368
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (3)369..513
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (4)514..612
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (5)613..708
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (6)709..790
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (7)791..885
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (8)886..1037
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (9)1038..1196
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (10)1197..1289
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (11)1290..1349
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (12)1350..1379
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (13)1380..1473
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (14)1474..1521
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (15)1522..1605
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (16)1606..1704
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (17)1705..1840
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (18)1841..1893
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (19)1894..1988
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (20)1989..2128
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (21)2129..2341
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (22)2342..2384
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (23)2385..2497
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (24)2498..4973
Gene:STAT3
Gene Synonym:APRF; HIES
Translation MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(102)-dbSNP:
complement(102)-g, adbSNP:17883843
334+a, cdbSNP:1803125
complement(436)-dbSNP:
complement(436)-g, cdbSNP:375760579
complement(465)-t, cdbSNP:146184566
549+dbSNP:
549+c, gdbSNP:17880940
complement(576)-t, cdbSNP:200440712
complement(588)-t, cdbSNP:200960081
complement(645)-dbSNP:
complement(645)-g, adbSNP:201846078
complement(669)-t, cdbSNP:386544964
complement(669)-g, adbSNP:17878478
complement(688..689)-, cdbSNP:35332755
complement(792)-dbSNP:
complement(792)-g, adbSNP:202126764
complement(834)-g, cdbSNP:374063766
complement(891)-dbSNP:
complement(891)-g, adbSNP:377095381
complement(933)-c, adbSNP:374524373
complement(947)-g, cdbSNP:371541785
complement(949)-t, cdbSNP:376677265
complement(963)-t, adbSNP:139588729
complement(1065)-dbSNP:
complement(1065)-c, adbSNP:200098006
1104+c, gdbSNP:1064110
complement(1119)-g, adbSNP:147186377
1164+a, gdbSNP:1064111
1179+c, tdbSNP:1141111
1243+dbSNP:
1243+c, tdbSNP:193922716
complement(1251)-g, adbSNP:200623682
complement(1252)-t, cdbSNP:371953916
complement(1285)-t, cdbSNP:368454926
complement(1293)-dbSNP:
complement(1293)-t, cdbSNP:201472943
1302+a, gdbSNP:1141112
complement(1362)-dbSNP:
complement(1362)-g, adbSNP:376080249
complement(1367)-g, adbSNP:373083464
complement(1383)-dbSNP:
complement(1383)-g, cdbSNP:143571879
1384+c, tdbSNP:113994135
1385+a, g, tdbSNP:113994136
1406+c, tdbSNP:397514766
complement(1443)-g, adbSNP:189708970
complement(1470)-g, adbSNP:138001349
complement(1477)-dbSNP:
complement(1477)-g, adbSNP:146946014
1483+a, gdbSNP:193922717
complement(1485)-t, cdbSNP:184867029
complement(1503)-t, cdbSNP:141151719
1508+a, gdbSNP:113994137
complement(1569)-dbSNP:
complement(1569)-g, adbSNP:147955721
1587+c, tdbSNP:1141115
complement(1603)-c, adbSNP:34460718
1618+dbSNP:
1618+c, tdbSNP:1141116
complement(1621)-g, cdbSNP:149214040
1627..1629+, gtgdbSNP:113994138
complement(1668)-g, adbSNP:369714894
complement(1699)-g, adbSNP:199996352
1710+dbSNP:
1710+a, gdbSNP:1141117
1716+c, tdbSNP:1141118
1719+c, tdbSNP:1141119
1722+c, tdbSNP:1141120
1728+c, gdbSNP:1141121
complement(1732)-t, cdbSNP:146620441
1746+c, tdbSNP:1064112
complement(1759)-c, adbSNP:145786768
1761+c, gdbSNP:1064113
1764+c, gdbSNP:1064114
1779+c, gdbSNP:1064115
1818+a, c, tdbSNP:1141122
1821+a, gdbSNP:1141123
1827+a, tdbSNP:1141125
1833+a, gdbSNP:1141126
complement(1837)-g, adbSNP:199855499
complement(1847)-dbSNP:
complement(1847)-c, adbSNP:372641163
1854+c, tdbSNP:1141127
1857+c, tdbSNP:1141128
1884+a, cdbSNP:1141129
1887+c, tdbSNP:1141131
complement(1890)-g, adbSNP:201555354
complement(1920)-dbSNP:
complement(1920)-g, adbSNP:146817483
1922+a, tdbSNP:1064116
1935+a, gdbSNP:1064117
1947+c, tdbSNP:1064118
1965+c, tdbSNP:1064119
1983+c, tdbSNP:1141144
2010+dbSNP:
2010+c, tdbSNP:1141145
2012+a, tdbSNP:193922719
complement(2016)-t, cdbSNP:370905622
2020+a, gdbSNP:193922720
complement(2023)-g, adbSNP:149791519
complement(2030..2031)-, tdbSNP:33997807
complement(2034)-t, cdbSNP:376413845
2064+a, gdbSNP:1064120
2065+a, cdbSNP:1064121
2067+a, cdbSNP:1064122
complement(2094)-g, adbSNP:117691970
2149+dbSNP:
2149+a, gdbSNP:113994139
2210+a, gdbSNP:193922721
complement(2289)-g, adbSNP:373256669
complement(2322)-t, adbSNP:139701269
complement(2331)-t, adbSNP:200529713
2374+dbSNP:
2374+c, tdbSNP:193922722
2420+dbSNP:
2420+c, tdbSNP:11547455
complement(2420)-g, adbSNP:386518970
complement(2468)-c, adbSNP:151033214
complement(2478)-g, adbSNP:376372615
complement(2521)-dbSNP:
complement(2521)-g, adbSNP:142236792
complement(2528)-g, adbSNP:140604473
complement(2529)-t, cdbSNP:147202525
complement(2532)-t, cdbSNP:368404940
complement(2535)-g, c, adbSNP:145244024
complement(2539)-t, cdbSNP:183996904
complement(2565)-g, adbSNP:374327257
complement(2579)-t, cdbSNP:368050581
complement(2584)-g, adbSNP:374107124
complement(2588)-c, adbSNP:7207492
complement(2600)-g, adbSNP:375752935
complement(2609)-g, cdbSNP:368388401
complement(2676..2677)-, adbSNP:201259337
2707+c, tdbSNP:1803126
complement(2764)-t, gdbSNP:41289087
complement(2770)-t, cdbSNP:374525108
complement(2872)-g, adbSNP:117735406
complement(2921)-g, adbSNP:113644902
complement(2955)-t, cdbSNP:186798539
complement(3094..3095)-, tdbSNP:368910594
complement(3135)-t, adbSNP:115090026
complement(3137)-c, adbSNP:11079042
complement(3222)-g, adbSNP:138998960
complement(3447)-, cdbSNP:373212106
complement(3496)-g, adbSNP:367884098
complement(3584)-t, cdbSNP:146907042
complement(3635)-c, adbSNP:184030721
complement(3678)-t, cdbSNP:377364072
complement(3718..3719)-, gdbSNP:35427318
complement(3749)-g, adbSNP:193126798
complement(3782)-t, cdbSNP:112608032
complement(3812)-g, adbSNP:372716251
complement(3813)-g, adbSNP:149628743
complement(3878)-t, cdbSNP:3744483
complement(3878)-t, cdbSNP:386585295
complement(3886)-g, adbSNP:75018295
complement(3904)-t, gdbSNP:188588928
complement(3936)-g, cdbSNP:183293865
complement(4050)-t, cdbSNP:190710939
complement(4070)-t, cdbSNP:75454844
complement(4090)-t, gdbSNP:185508151
complement(4157)-c, adbSNP:111904020
complement(4181)-g, cdbSNP:182824638
4224+c, tdbSNP:1053004
complement(4246)-t, cdbSNP:373503231
complement(4387)-c, adbSNP:10775
complement(4394)-g, adbSNP:376764794
4406+a, gdbSNP:1053005
complement(4406)-g, adbSNP:386514322
complement(4484)-t, cdbSNP:138326799
4554+a, cdbSNP:150467429
4700+a, gdbSNP:1053023
complement(4896)-t, cdbSNP:200029754
complement(4897)-, adbSNP:398041696
complement(4898)-g, adbSNP:80323123
complement(4918)-, adbSNP:397857989
complement(4919)-c, adbSNP:147045863
Title MicroRNA let-7 downregulates STAT3 phosphorylation in pancreatic cancer cells by increasing SOCS3 expression .
Author Patel K, Kollory A, Takashima A, Sarkar S, Faller DV and Ghosh SK.
Journal Cancer Lett. 347 (1), 54-64 (2014)
Title The STAT3-binding long noncoding RNA lnc-DC controls human dendritic cell differentiation .
Author Wang P, Xue Y, Han Y, Lin L, Wu C, Xu S, Jiang Z, Xu J, Liu Q and Cao X.
Journal Science 344 (6181), 310-313 (2014)
Title Interleukin-17 increases the expression of Toll-like receptor 3 via the STAT3 pathway in rheumatoid arthritis fibroblast-like synoviocytes .
Author Lee SY, Yoon BY, Kim JI, Heo YM, Woo YJ, Park SH, Kim HY, Kim SI and Cho ML.
Journal Immunology 141 (3), 353-361 (2014)
Title Jumonji domain-containing protein 2B silencing induces DNA damage response via STAT3 pathway in colorectal cancer .
Author Chen L, Fu L, Kong X, Xu J, Wang Z, Ma X, Akiyama Y, Chen Y and Fang J.
Journal Br. J. Cancer 110 (4), 1014-1026 (2014)
Title Suppression of STAT3 by chemically modified siRNAs increases the chemotherapeutic sensitivity of parental and cisplatin-resistant non-small cell lung cancer cells .
Author Tezcanli Kaymaz B, Bozok Cetintas V, Eroglu Z and Kosova B.
Journal J BUON 19 (1), 145-152 (2014)
Title STAT3 activation by cytokines utilizing gp130 and related transducers involves a secondary modification requiring an H7-sensitive kinase .
Author Boulton TG, Zhong Z, Wen Z, Darnell JE Jr, Stahl N and Yancopoulos GD.
Journal Proc. Natl. Acad. Sci. U.S.A. 92 (15), 6915-6919 (1995)
Title Requirement of serine phosphorylation for formation of STAT-promoter complexes .
Author Zhang X, Blenis J, Li HC, Schindler C and Chen-Kiang S.
Journal Science 267 (5206), 1990-1994 (1995)
Title Molecular cloning of APRF, a novel IFN-stimulated gene factor 3 p91-related transcription factor involved in the gp130-mediated signaling pathway .
Author Akira S, Nishio Y, Inoue M, Wang XJ, Wei S, Matsusaka T, Yoshida K, Sudo T, Naruto M and Kishimoto T.
Journal Cell 77 (1), 63-71 (1994)
Title Autosomal Dominant Hyper IgE Syndrome .
Author Hsu,A.P., Davis,J., Puck,J.M., Holland,S.M. and Freeman,A.F.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Analysis of mutation in human cells by using an Epstein-Barr virus shuttle system .
Author DuBridge,R.B., Tang,P., Hsia,H.C., Leong,P.M., Miller,J.H. and Calos,M.P.
Journal Mol. Cell. Biol. 7 (1), 379-387 (1987)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.