• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_139276 Homo sapiens signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $809.00 $760.00 15

*Business Day

Related Services

RefSeq Version NM_139276.2, 47080104
Length 4978 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3), transcript variant 1, mRNA.
Product signal transducer and activator of transcription 3 isoform 1
Comment

Summary: The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. Three alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longest transcript, and encodes the longest isoform (1).

RefSeq NP_644805.1
CDS 241..2553
Misc Feature(1)148..150
Misc Feature(2)218..240
Misc Feature(3)218..240
Misc Feature(4)244..588
Misc Feature(5)244..588
Misc Feature(6)655..1197
Misc Feature(7)688..726
Misc Feature(8)1201..1962
Misc Feature(9)1900..2385
Misc Feature(10)order(2011..2013,2065..2067,2146..2148,2152..2154)
Misc Feature(11)order(2149..2151,2197..2199)
Misc Feature(12)order(2179..2184,2368..2370)
Misc Feature(13)2209..2211
Misc Feature(14)2260..2262
Misc Feature(15)2293..2295
Misc Feature(16)2293..2295
Misc Feature(17)2311..2313
Misc Feature(18)2353..2355
Misc Feature(19)2353..2355
Misc Feature(20)2353..2355
Misc Feature(21)2353..2355
Misc Feature(22)2353..2355
Misc Feature(23)2353..2355
Misc Feature(24)2353..2355
Misc Feature(25)2353..2355
Misc Feature(26)2353..2355
Misc Feature(27)2419..2421
Misc Feature(28)2419..2421
Misc Feature(29)2419..2421
Misc Feature(30)2419..2421
Misc Feature(31)2419..2421
Misc Feature(32)2419..2421
Misc Feature(33)2419..2421
Exon (1)1..217
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (2)218..368
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (3)369..513
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (4)514..612
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (5)613..708
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (6)709..790
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (7)791..885
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (8)886..1037
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (9)1038..1196
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (10)1197..1289
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (11)1290..1349
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (12)1350..1379
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (13)1380..1473
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (14)1474..1521
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (15)1522..1605
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (16)1606..1704
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (17)1705..1840
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (18)1841..1893
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (19)1894..1988
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (20)1989..2128
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (21)2129..2341
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (22)2342..2384
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (23)2385..2497
Gene:STAT3
Gene Synonym:APRF; HIES
Exon (24)2498..4973
Gene:STAT3
Gene Synonym:APRF; HIES
Translation MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(102)-dbSNP:
complement(102)-g, adbSNP:17883843
complement(334)-c, adbSNP:1803125
complement(387)-dbSNP:
complement(387)-, tdbSNP:66461250
complement(465)-t, cdbSNP:146184566
complement(549)-dbSNP:
complement(549)-g, cdbSNP:17880940
complement(576)-t, cdbSNP:200440712
complement(588)-t, cdbSNP:200960081
complement(645)-dbSNP:
complement(645)-g, adbSNP:201846078
complement(669)-g, adbSNP:17878478
complement(688..689)-, cdbSNP:35332755
complement(792)-dbSNP:
complement(792)-g, adbSNP:202126764
complement(951)-dbSNP:
complement(951)-t, cdbSNP:17882069
complement(963)-t, adbSNP:139588729
complement(1065)-dbSNP:
complement(1065)-c, adbSNP:200098006
complement(1104)-g, cdbSNP:1064110
complement(1119)-g, adbSNP:147186377
complement(1164)-g, adbSNP:1064111
complement(1179)-t, cdbSNP:1141111
complement(1243)-dbSNP:
complement(1243)-t, cdbSNP:193922716
complement(1251)-g, adbSNP:200623682
complement(1293)-dbSNP:
complement(1293)-t, cdbSNP:201472943
complement(1302)-g, adbSNP:1141112
complement(1383)-dbSNP:
complement(1383)-g, cdbSNP:143571879
complement(1384)-t, cdbSNP:113994135
complement(1385)-t, g, adbSNP:113994136
complement(1443)-g, adbSNP:189708970
complement(1470)-g, adbSNP:138001349
complement(1477)-dbSNP:
complement(1477)-g, adbSNP:146946014
complement(1483)-g, adbSNP:193922717
complement(1485)-t, cdbSNP:184867029
complement(1503)-t, cdbSNP:141151719
complement(1508)-g, adbSNP:113994137
complement(1569)-dbSNP:
complement(1569)-g, adbSNP:147955721
complement(1587)-t, cdbSNP:1141115
complement(1591)-t, gdbSNP:143401860
complement(1603)-c, adbSNP:34460718
complement(1618)-dbSNP:
complement(1618)-t, cdbSNP:1141116
complement(1621)-g, cdbSNP:149214040
complement(1627..1629)-, gtgdbSNP:113994138
complement(1699)-g, adbSNP:199996352
complement(1710)-dbSNP:
complement(1710)-g, adbSNP:1141117
complement(1716)-t, cdbSNP:1141118
complement(1719)-t, cdbSNP:1141119
complement(1722)-t, cdbSNP:1141120
complement(1728)-g, cdbSNP:1141121
complement(1732)-t, cdbSNP:146620441
complement(1746)-t, cdbSNP:1064112
complement(1759)-c, adbSNP:145786768
complement(1761)-g, cdbSNP:1064113
complement(1764)-g, cdbSNP:1064114
complement(1779)-g, cdbSNP:1064115
complement(1818)-t, c, adbSNP:1141122
complement(1821)-g, adbSNP:1141123
complement(1827)-t, adbSNP:1141125
complement(1833)-g, adbSNP:1141126
complement(1837)-g, adbSNP:199855499
complement(1854)-dbSNP:
complement(1854)-t, cdbSNP:1141127
complement(1857)-t, cdbSNP:1141128
complement(1884)-c, adbSNP:1141129
complement(1887)-t, cdbSNP:1141131
complement(1890)-g, adbSNP:201555354
complement(1920)-dbSNP:
complement(1920)-g, adbSNP:146817483
complement(1922)-t, adbSNP:1064116
complement(1935)-g, adbSNP:1064117
complement(1947)-t, cdbSNP:1064118
complement(1965)-t, cdbSNP:1064119
complement(1983)-t, cdbSNP:1141144
complement(2010)-dbSNP:
complement(2010)-t, cdbSNP:1141145
complement(2012)-t, adbSNP:193922719
complement(2020)-g, adbSNP:193922720
complement(2023)-g, adbSNP:149791519
complement(2030..2031)-, tdbSNP:33997807
complement(2064)-g, adbSNP:1064120
complement(2065)-c, adbSNP:1064121
complement(2067)-c, adbSNP:1064122
complement(2094)-g, adbSNP:117691970
complement(2149)-dbSNP:
complement(2149)-g, adbSNP:113994139
complement(2210)-g, adbSNP:193922721
complement(2322)-t, adbSNP:139701269
complement(2331)-t, adbSNP:200529713
complement(2374)-dbSNP:
complement(2374)-t, cdbSNP:193922722
complement(2420)-dbSNP:
complement(2420)-t, cdbSNP:11547455
complement(2468)-c, adbSNP:151033214
complement(2521)-dbSNP:
complement(2521)-g, adbSNP:142236792
complement(2528)-g, adbSNP:140604473
complement(2529)-t, cdbSNP:147202525
complement(2535)-g, c, adbSNP:145244024
complement(2539)-t, cdbSNP:183996904
complement(2588)-c, adbSNP:7207492
complement(2676..2677)-, adbSNP:201259337
complement(2699)-, adbSNP:68066110
complement(2707)-t, cdbSNP:1803126
complement(2764)-t, gdbSNP:41289087
complement(2872)-g, adbSNP:117735406
complement(2921)-g, adbSNP:113644902
complement(2955)-t, cdbSNP:186798539
complement(3099..3100)-, tdbSNP:71775865
complement(3135)-t, adbSNP:115090026
complement(3137)-c, adbSNP:11079042
complement(3222)-g, adbSNP:138998960
complement(3270)-, tdbSNP:71697627
complement(3426..3427)-, tgdbSNP:77457954
complement(3584)-t, cdbSNP:146907042
complement(3635)-c, adbSNP:184030721
complement(3718..3719)-, gdbSNP:35427318
complement(3749)-g, adbSNP:193126798
complement(3782)-t, cdbSNP:112608032
complement(3813)-g, adbSNP:149628743
complement(3878)-t, cdbSNP:3744483
complement(3886)-g, adbSNP:75018295
complement(3904)-t, gdbSNP:188588928
complement(3936)-g, cdbSNP:183293865
complement(4050)-t, cdbSNP:190710939
complement(4070)-t, cdbSNP:75454844
complement(4090)-t, gdbSNP:185508151
complement(4157)-c, adbSNP:111904020
complement(4181)-g, cdbSNP:182824638
complement(4224)-t, cdbSNP:1053004
complement(4387)-c, adbSNP:10775
complement(4406)-g, adbSNP:1053005
complement(4484)-t, cdbSNP:138326799
complement(4554)-c, adbSNP:150467429
complement(4700)-g, adbSNP:1053023
complement(4896)-t, cdbSNP:200029754
complement(4898)-g, adbSNP:80323123
complement(4917..4918)-, aadbSNP:71768598
complement(4918)-, a, aaadbSNP:34479652
complement(4919)-c, adbSNP:147045863
Gene SymbolSTAT3
Gene SynonymAPRF; HIES
Chromosome17
Locus Map17q21.31
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_003150 Homo sapiens signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3), transcript variant 2, mRNA. In-stock $809.00 $760.00 15
NM_139276 Homo sapiens signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3), transcript variant 1, mRNA. In-stock $809.00 $760.00 15
NM_213662 Homo sapiens signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3), transcript variant 3, mRNA. On-demand $849.00 20
Title STAT3 as a therapeutic target for Epstein-Barr virus (EBV): associated nasopharyngeal carcinoma .
Author Ho,Y., Tsao,S.W., Zeng,M. and Lui,V.W.
Journal Cancer Lett. 330 (2), 141-149 (2013)
Title MicroRNA-18a modulates STAT3 activity through negative regulation of PIAS3 during gastric adenocarcinogenesis .
Author Wu,W., Takanashi,M., Borjigin,N., Ohno,S.I., Fujita,K., Hoshino,S., Osaka,Y., Tsuchida,A. and Kuroda,M.
Journal Br. J. Cancer 108 (3), 653-661 (2013)
Title FACS analysis of Stat3/5 signaling reveals sensitivity to G-CSF and IL-6 as a significant prognostic factor in pediatric AML: a Children's Oncology Group report .
Author Redell,M.S., Ruiz,M.J., Gerbing,R.B., Alonzo,T.A., Lange,B.J., Tweardy,D.J. and Meshinchi,S.
Journal Blood 121 (7), 1083-1093 (2013)
Title Signal transducer and activator of transcription 3 (STAT3) regulates collagen-induced platelet aggregation independently of its transcription factor activity .
Author Zhou,Z., Gushiken,F.C., Bolgiano,D., Salsbery,B.J., Aghakasiri,N., Jing,N., Wu,X., Vijayan,K.V., Rumbaut,R.E., Adachi,R., Lopez,J.A. and Dong,J.F.
Journal Circulation 127 (4), 476-485 (2013)
Title STAT3 suppresses transcription of proapoptotic genes in cancer cells with the involvement of its N-terminal domain .
Author Timofeeva,O.A., Tarasova,N.I., Zhang,X., Chasovskikh,S., Cheema,A.K., Wang,H., Brown,M.L. and Dritschilo,A.
Journal Proc. Natl. Acad. Sci. U.S.A. 110 (4), 1267-1272 (2013)
Title STAT3 activation by cytokines utilizing gp130 and related transducers involves a secondary modification requiring an H7-sensitive kinase .
Author Boulton,T.G., Zhong,Z., Wen,Z., Darnell,J.E. Jr., Stahl,N. and Yancopoulos,G.D.
Journal Proc. Natl. Acad. Sci. U.S.A. 92 (15), 6915-6919 (1995)
Title The role of shared receptor motifs and common Stat proteins in the generation of cytokine pleiotropy and redundancy by IL-2, IL-4, IL-7, IL-13, and IL-15 .
Author Lin,J.X., Migone,T.S., Tsang,M., Friedmann,M., Weatherbee,J.A., Zhou,L., Yamauchi,A., Bloom,E.T., Mietz,J., John,S. et al.
Journal Immunity 2 (4), 331-339 (1995)
Title Requirement of serine phosphorylation for formation of STAT-promoter complexes .
Author Zhang,X., Blenis,J., Li,H.C., Schindler,C. and Chen-Kiang,S.
Journal Science 267 (5206), 1990-1994 (1995)
Title Molecular cloning of APRF, a novel IFN-stimulated gene factor 3 p91-related transcription factor involved in the gp130-mediated signaling pathway .
Author Akira,S., Nishio,Y., Inoue,M., Wang,X.J., Wei,S., Matsusaka,T., Yoshida,K., Sudo,T., Naruto,M. and Kishimoto,T.
Journal Cell 77 (1), 63-71 (1994)
Title Analysis of mutation in human cells by using an Epstein-Barr virus shuttle system .
Author DuBridge,R.B., Tang,P., Hsia,H.C., Leong,P.M., Miller,J.H. and Calos,M.P.
Journal Mol. Cell. Biol. 7 (1), 379-387 (1987)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.