• THAT   AND
  • THAT   AND


Rattus norvegicus proopiomelanocortin (Pomc), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_139326 Rattus norvegicus proopiomelanocortin (Pomc), mRNA. Full Lenth $280.43
ORF Sequence $205.32
RefSeq Version NM_139326.2, 40254726
Length 967 bp
Structure linear
Update Date 10-APR-2011
Organism Rattus norvegicus (Norway rat)
Definition Rattus norvegicus proopiomelanocortin (Pomc), mRNA.
Product pro-opiomelanocortin
Comment

COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC058443.1. On Dec 20, 2003 this sequence version replaced gi:21326456.

RefSeq NP_647542.1
CDS 122..829
Translation MPRFCYSRSGALLLALLLQTSIDVWSWCLESSQCQDLTTESNLLACIRACRLDLSAETPV FPGNGDEQPLTENPRKYVMGHFRWDRFGPRNSSSAGGSAQRRAEEETAGGDGRPEPSPRE GKRSYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEFKRELEGEQPDGLEHVLEP DTEKADGPYRVEHFRWGNPPKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
Gene SymbolPomc
Gene SynonymPomc1; Pomc2
Chromosome6
Locus Map6q14
All Transcripts NM_139326
Title alpha-melanocyte-stimulating hormone modulates lipopolysaccharide plus interferon-gamma-induced tumor necrosis factor-alpha expression but not tumor necrosis factor-alpha receptor expression in cultured hypothalamic neurons .
Author Caruso,C., Sanchez,M., Durand,D., Perez Mde,L., Gonzalez,P.V., Lasaga,M. and Scimonelli,T.N.
Journal J. Neuroimmunol. 227 (1-2), 52-59 (2010)
Title A role of phosphodiesterase-3B pathway in mediating leptin action on proopiomelanocortin and neurotensin neurons in the hypothalamus .
Author Sahu,A.
Journal Neurosci. Lett. 479 (1), 18-21 (2010)
Title Involvement of alpha-MSH in the social isolation induced anxiety- and depression-like behaviors in rat .
Author Kokare,D.M., Dandekar,M.P., Singru,P.S., Gupta,G.L. and Subhedar,N.K.
Journal Neuropharmacology 58 (7), 1009-1018 (2010)
Title A potential role for hypothalamomedullary POMC projections in leptin-induced suppression of food intake .
Author Zheng,H., Patterson,L.M., Rhodes,C.J., Louis,G.W., Skibicka,K.P., Grill,H.J., Myers,M.G. Jr. and Berthoud,H.R.
Journal Am. J. Physiol. Regul. Integr. Comp. Physiol. 298 (3), R720-R728 (2010)
Title Changes in NPY and POMC, but not serotonin transporter, following a restricted feeding/repletion protocol in rats .
Author Lauzurica,N., Garcia-Garcia,L., Pinto,S., Fuentes,J.A. and Delgado,M.
Journal Brain Res. 1313, 103-112 (2010)
Title Beta-endorphin cells in the arcuate nucleus: projections to the supraoptic nucleus and changes in expression during pregnancy and parturition .
Author Douglas,A.J., Bicknell,R.J., Leng,G., Russell,J.A. and Meddle,S.L.
Journal J. Neuroendocrinol. 14 (10), 768-777 (2002)
Title Activation of central melanocortin pathways by fenfluramine .
Author Heisler,L.K., Cowley,M.A., Tecott,L.H., Fan,W., Low,M.J., Smart,J.L., Rubinstein,M., Tatro,J.B., Marcus,J.N., Holstege,H., Lee,C.E., Cone,R.D. and Elmquist,J.K.
Journal Science 297 (5581), 609-611 (2002)
Title Effects of alpha-MSH on kainic acid induced changes in core temperature in rats .
Author Oprica,M., Forslin Aronsson,A., Post,C., Eriksson,C., Ahlenius,S., Popescu,L.M. and Schultzberg,M.
Journal Peptides 23 (1), 143-149 (2002)
Title Structure of the rat pro-opiomelanocortin (POMC) gene .
Author Drouin,J., Chamberland,M., Charron,J., Jeannotte,L. and Nemer,M.
Journal FEBS Lett. 193 (1), 54-58 (1985)
Title Most of the coding region of rat ACTH beta--LPH precursor gene lacks intervening sequences .
Author Drouin,J. and Goodman,H.M.
Journal Nature 288 (5791), 610-613 (1980)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878