• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens claudin 14 (CLDN14), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu20415 Homo sapiens claudin 14 (CLDN14), transcript variant 1, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu20415C Homo sapiens claudin 14 (CLDN14), transcript variant 1, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_144492.2, 225703134
Length 720 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens claudin 14 (CLDN14), transcript variant 1, mRNA.
Product claudin-14
Comment

Summary: Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. The encoded protein also binds specifically to the WW domain of Yes-associated protein. Defects in this gene are the cause of an autosomal recessive form of nonsyndromic sensorineural deafness. It is also reported that four synonymous variants in this gene are associated with kidney stones and reduced bone mineral density. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jun 2010].


Transcript Variant: This variant (alpha) represents the longest transcript. All five variants encode the same protein.

RefSeq NP_652763.1
CDS 868..1587
Misc Feature(1)850..852
Misc Feature(2)889..951
Misc Feature(3)889..951
Misc Feature(4)934..1410
Misc Feature(5)1111..1173
Misc Feature(6)1213..1275
Misc Feature(7)1354..1416
Exon (1)1..596
Gene:CLDN14
Gene Synonym:DFNB29
Exon (2)597..786
Gene:CLDN14
Gene Synonym:DFNB29
Exon (3)787..1942
Gene:CLDN14
Gene Synonym:DFNB29
Translation MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTG IYQCQIYRSLLALPQDLQAARALMVISCLLSGIACACAVIGMKCTRCAKGTPAKTTFAIL GGTLFILAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTL LCLSCQDEAPYRPYQAPPRATTTTANTAPAYQPPAAYKDNRAPSVTSATHSGYRLNDYV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(23..25)-dbSNP:
complement(23..25)-, tccdbSNP:139003220
complement(48)-c, adbSNP:375811545
complement(147)-t, cdbSNP:372584176
complement(153)-g, cdbSNP:116629563
complement(199)-g, adbSNP:376942377
complement(274)-t, adbSNP:370189669
complement(288)-t, cdbSNP:150344346
complement(341)-g, cdbSNP:117804848
381+c, tdbSNP:140333712
complement(388)-t, cdbSNP:219742
complement(414)-g, cdbSNP:188733
complement(436)-g, adbSNP:78291168
complement(439)-g, adbSNP:369614226
complement(448)-t, cdbSNP:151272065
complement(492)-t, cdbSNP:181645276
complement(495)-g, adbSNP:376974087
complement(541)-g, adbSNP:372217521
complement(547)-g, adbSNP:114492024
complement(689)-dbSNP:
complement(689)-t, cdbSNP:73902533
complement(708)-t, cdbSNP:181028658
complement(755)-g, adbSNP:28653283
complement(811)-dbSNP:
complement(811)-t, cdbSNP:188479887
complement(831)-t, cdbSNP:149049781
complement(863)-t, cdbSNP:368231049
complement(877)-t, cdbSNP:374578221
complement(878)-g, adbSNP:113831133
882+c, tdbSNP:387907416
complement(883)-t, cdbSNP:202117396
885+a, gdbSNP:387907417
complement(918)-g, adbSNP:150040476
complement(919)-g, adbSNP:369883669
927+c, tdbSNP:387907415
complement(930)-t, cdbSNP:117560775
complement(969)-t, cdbSNP:146395322
complement(973)-t, cdbSNP:142205038
complement(993)-t, cdbSNP:140177046
complement(996)-g, adbSNP:150731625
complement(997)-t, cdbSNP:141139613
complement(1034)-t, cdbSNP:371100799
complement(1052)-t, cdbSNP:148223897
complement(1083)-t, cdbSNP:370315827
complement(1108)-g, adbSNP:143628692
complement(1109)-t, cdbSNP:368027306
complement(1110)-t, cdbSNP:219779
1121+a, tdbSNP:74315437
complement(1161)-g, adbSNP:374400022
complement(1162)-t, cdbSNP:371106978
complement(1167)-g, adbSNP:113350364
1168+a, gdbSNP:74315438
complement(1183)-g, adbSNP:140257182
complement(1189)-t, cdbSNP:377019596
complement(1190)-g, adbSNP:373823945
complement(1204)-t, cdbSNP:138631461
complement(1214)-g, adbSNP:370342285
complement(1219)-g, cdbSNP:377333347
complement(1228)-t, cdbSNP:150201704
complement(1259)-g, adbSNP:373777126
complement(1273)-t, cdbSNP:140918123
complement(1280)-t, cdbSNP:151069240
complement(1281)-t, cdbSNP:142846225
complement(1291)-t, cdbSNP:146755542
complement(1293)-g, adbSNP:140671150
complement(1338)-t, cdbSNP:146860442
complement(1355)-g, adbSNP:143797113
complement(1362)-g, adbSNP:373672296
complement(1366)-t, cdbSNP:377158611
1379+g, tdbSNP:75617474
complement(1388)-g, adbSNP:140196815
complement(1392)-g, adbSNP:373226526
complement(1407)-t, cdbSNP:369688436
complement(1426)-c, adbSNP:375904468
complement(1447)-g, adbSNP:372105353
complement(1454)-g, adbSNP:200651246
complement(1455)-t, gdbSNP:144371384
complement(1457)-g, adbSNP:374682296
complement(1458)-t, cdbSNP:374840285
complement(1481)-g, adbSNP:149671826
complement(1485)-g, adbSNP:184035890
complement(1488)-g, adbSNP:139437157
complement(1489)-t, cdbSNP:371297575
complement(1500)-g, adbSNP:61745291
complement(1524)-g, adbSNP:143566360
1530+a, gdbSNP:387907414
complement(1531)-t, cdbSNP:138008896
complement(1554)-g, adbSNP:219780
complement(1557)-g, adbSNP:149733854
complement(1582)-t, cdbSNP:201218449
complement(1597)-g, cdbSNP:139628442
complement(1635)-t, cdbSNP:199523516
complement(1638)-t, cdbSNP:114551506
complement(1653)-t, cdbSNP:369966830
complement(1694)-t, cdbSNP:112112443
complement(1752)-t, cdbSNP:150553857
complement(1891)-g, cdbSNP:377710646
complement(1921)-t, cdbSNP:142629054
complement(1922)-t, gdbSNP:185515617
complement(1933..1934)-, aaaaccdbSNP:370594336
complement(1934)-c, adbSNP:201508874
Gene SymbolCLDN14
Gene SynonymDFNB29
Chromosome21
Locus Map21q22.3
Title Frequency of rare allelic variation in candidate genes among individuals with low and high urinary calcium excretion .
Author Toka HR, Genovese G, Mount DB, Pollak MR and Curhan GC.
Journal PLoS ONE 8 (8), E71885 (2013)
Title Analysis of CLDN14 gene in deaf Moroccan patients with non-syndromic hearing loss .
Author Charif M, Bakhchane A, Abidi O, Boulouiz R, Eloualid A, Roky R, Rouba H, Kandil M, Lenaers G and Barakat A.
Journal Gene 523 (1), 103-105 (2013)
Title Phenotypic variability of CLDN14 mutations causing DFNB29 hearing loss in the Pakistani population .
Author Bashir ZE, Latief N, Belyantseva IA, Iqbal F, Riazuddin SA, Khan SN, Friedman TB, Riazuddin S and Riazuddin S.
Journal J. Hum. Genet. 58 (2), 102-108 (2013)
Title Human claudin-8 and -14 are receptors capable of conveying the cytotoxic effects of Clostridium perfringens enterotoxin .
Author Shrestha A and McClane BA.
Journal MBio 4 (1) (2013)
Title Impact of ancestry and common genetic variants on QT interval in African Americans .
Author Smith JG, Avery CL, Evans DS, Nalls MA, Meng YA, Smith EN, Palmer C, Tanaka T, Mehra R, Butler AM, Young T, Buxbaum SG, Kerr KF, Berenson GS, Schnabel RB, Li G, Ellinor PT, Magnani JW, Chen W, Bis JC, Curb JD, Hsueh WC, Rotter JI, Liu Y, Newman AB, Limacher MC, North KE, Reiner AP, Quibrera PM, Schork NJ, Singleton AB, Psaty BM, Soliman EZ, Solomon AJ, Srinivasan SR, Alonso A, Wallace R, Redline S, Zhang ZM, Post WS, Zonderman AB, Taylor HA, Murray SS, Ferrucci L, Arking DE, Evans MK, Fox ER, Sotoodehnia N, Heckbert SR, Whitsel EA and Newton-Cheh C.
Journal Circ Cardiovasc Genet 5 (6), 647-655 (2012)
Title Claudin-based barrier in simple and stratified cellular sheets .
Author Tsukita S and Furuse M.
Journal Curr. Opin. Cell Biol. 14 (5), 531-536 (2002)
Title Multifunctional strands in tight junctions .
Author Tsukita S, Furuse M and Itoh M.
Journal Nat. Rev. Mol. Cell Biol. 2 (4), 285-293 (2001)
Title The roles of claudin superfamily proteins in paracellular transport .
Author Heiskala M, Peterson PA and Yang Y.
Journal Traffic 2 (2), 93-98 (2001)
Title Mutations in the gene encoding tight junction claudin-14 cause autosomal recessive deafness DFNB29 .
Author Wilcox ER, Burton QL, Naz S, Riazuddin S, Smith TN, Ploplis B, Belyantseva I, Ben-Yosef T, Liburd NA, Morell RJ, Kachar B, Wu DK, Griffith AJ, Riazuddin S and Friedman TB.
Journal Cell 104 (1), 165-172 (2001)
Title Tight junctions of the blood-brain barrier .
Author Kniesel U and Wolburg H.
Journal Cell. Mol. Neurobiol. 20 (1), 57-76 (2000)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.