• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens prokineticin receptor 2 (PROKR2), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu23580 Homo sapiens prokineticin receptor 2 (PROKR2), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu23580C Homo sapiens prokineticin receptor 2 (PROKR2), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_144773.2, 30581162
Length 1155 bp
Structure linear
Update Date 11-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens prokineticin receptor 2 (PROKR2), mRNA.
Product prokineticin receptor 2
Comment

Summary: Prokineticins are secreted proteins that can promote angiogenesis and induce strong gastrointestinal smooth muscle contraction. The protein encoded by this gene is an integral membrane protein and G protein-coupled receptor for prokineticins. The encoded protein is similar in sequence to GPR73, another G protein-coupled receptor for prokineticins. [provided by RefSeq, Jul 2008].

RefSeq NP_658986.1
CDS 1..1155
Misc Feature(1)163..225
Misc Feature(2)163..225
Misc Feature(3)196..>660
Misc Feature(4)226..987
Misc Feature(5)268..330
Misc Feature(6)409..471
Misc Feature(7)514..576
Misc Feature(8)670..732
Misc Feature(9)820..882
Misc Feature(10)940..1002
Exon (1)459..1155
Gene:PROKR2
Gene Synonym:dJ680N4.3; GPR73b; GPR73L1; GPRg2; HH3; KAL3; PKR2
Translation MAAQNGNTSFTPNFNPPQDHASSLSFNFSYGDYDLPMDEDEDMTKTRTFFAAKIVIGIAL AGIMLVCGIGNFVFIAALTRYKKLRNLTNLLIANLAISDFLVAIICCPFEMDYYVVRQLS WEHGHVLCASVNYLRTVSLYVSTNALLAIAIDRYLAIVHPLKPRMNYQTASFLIALVWMV SILIAIPSAYFATETVLFIVKSQEKIFCGQIWPVDQQLYYKSYFLFIFGVEFVGPVVTMT LCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPFYGFTIVRDF FPTVFVKEKHYLTAFYVVECIAMSNSMINTVCFVTVKNNTMKYFKKMMLLHWRPSQRGSK SSADLDLRTNGVPTTEEVDCIRLK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(35)-dbSNP:
complement(35)-g, cdbSNP:147773715
complement(55)-t, cdbSNP:146062524
complement(72)-g, adbSNP:375646689
complement(89)-t, cdbSNP:372654229
complement(90)-g, adbSNP:376513173
complement(94)-t, cdbSNP:267606007
complement(117)-t, cdbSNP:200262756
complement(132)-g, adbSNP:373511474
complement(150)-g, adbSNP:149123899
complement(151)-t, cdbSNP:144994507
complement(163)-t, cdbSNP:146963803
complement(169)-c, adbSNP:201283126
complement(201)-g, adbSNP:201898089
complement(205)-t, cdbSNP:372651342
complement(225)-g, adbSNP:139296723
complement(253)-g, c, adbSNP:141090506
complement(281)-t, cdbSNP:267606006
complement(286)-t, cdbSNP:375763923
complement(294)-g, adbSNP:146061254
complement(337)-g, adbSNP:202203360
complement(343)-t, cdbSNP:138672528
complement(349)-g, adbSNP:142008002
complement(375)-g, adbSNP:148596437
complement(376)-t, cdbSNP:200048973
complement(381)-g, cdbSNP:189546592
complement(385)-t, cdbSNP:367865350
complement(390)-g, adbSNP:144778137
complement(391)-t, cdbSNP:374021985
complement(403)-g, adbSNP:149396342
complement(408)-g, adbSNP:371754636
complement(409)-t, cdbSNP:139259742
complement(413)-g, adbSNP:374834120
complement(420)-g, adbSNP:199794008
complement(442)-t, cdbSNP:370778947
complement(453)-c, adbSNP:368328895
complement(465)-dbSNP:
complement(465)-g, adbSNP:3746684
complement(466)-t, cdbSNP:200887188
complement(472)-t, cdbSNP:368732206
complement(507)-t, cdbSNP:142753046
complement(525)-g, cdbSNP:3746683
complement(533)-g, cdbSNP:201835496
complement(563)-g, adbSNP:376239580
complement(585)-g, cdbSNP:3746682
complement(597)-g, adbSNP:148066986
complement(604)-t, cdbSNP:200755554
629+a, gdbSNP:74315417
complement(690)-g, adbSNP:377074263
complement(708)-t, cdbSNP:143615891
complement(711)-g, adbSNP:192855237
complement(743)-t, cdbSNP:376142095
complement(779)-g, adbSNP:370738961
complement(790)-g, adbSNP:148868355
complement(796)-g, adbSNP:146729363
complement(797)-t, cdbSNP:143647776
complement(802)-g, adbSNP:78861628
complement(809)-t, cdbSNP:146544539
complement(811)-t, cdbSNP:374194956
complement(815)-t, gdbSNP:188744190
complement(816)-t, cdbSNP:367826294
complement(821)-t, adbSNP:369831329
complement(858)-g, cdbSNP:375874356
complement(868)-g, adbSNP:149992595
complement(877)-t, cdbSNP:201311009
complement(889)-t, cdbSNP:139399061
complement(896)-t, adbSNP:372968364
complement(904)-g, adbSNP:199958585
complement(912)-t, cdbSNP:201600683
complement(916)-t, cdbSNP:199696443
complement(943)-g, adbSNP:200449168
complement(963)-g, adbSNP:142257149
969+a, gdbSNP:74315419
complement(991)-t, cdbSNP:117106081
complement(999)-g, adbSNP:138101742
complement(1000)-t, cdbSNP:371564610
complement(1005)-t, cdbSNP:150381386
complement(1042)-t, cdbSNP:368145317
complement(1069)-g, adbSNP:375036628
complement(1110)-g, adbSNP:76049287
complement(1111)-t, g, cdbSNP:201023639
complement(1122)-t, gdbSNP:76469093
complement(1154)-c, adbSNP:147311278
Gene SymbolPROKR2
Gene SynonymdJ680N4.3; GPR73b; GPR73L1; GPRg2; HH3; KAL3; PKR2
Chromosome20
Locus Map20p12.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_144773 Homo sapiens prokineticin receptor 2 (PROKR2), mRNA. In-stock $99.00 5-7
NM_144773 Homo sapiens prokineticin receptor 2 (PROKR2), mRNA. In-stock $99.00 5-7
Title TSHZ1-dependent gene regulation is essential for olfactory bulb development and olfaction .
Author Ragancokova,D., Rocca,E., Oonk,A.M., Schulz,H., Rohde,E., Bednarsch,J., Feenstra,I., Pennings,R.J., Wende,H. and Garratt,A.N.
Journal J. Clin. Invest. 124 (3), 1214-1227 (2014)
Title Greater prevalence of PROKR2 mutations in Kallmann syndrome patients from the Maghreb than in European patients .
Author Sarfati J, Fouveaut C, Leroy C, Jeanpierre M, Hardelin JP and Dode C.
Journal Eur. J. Endocrinol. 169 (6), 805-809 (2013)
Title Functional analysis of the distal region of the third intracellular loop of PROKR2 .
Author Zhou XT, Chen DN, Xie ZQ, Peng Z, Xia KD, Liu HD, Liu W, Su B and Li JD.
Journal Biochem. Biophys. Res. Commun. 439 (1), 12-17 (2013)
Title Prokineticin receptor variants (PKR1-I379V and PKR2-V331M) are protective genotypes in human early pregnancy .
Author Su MT, Lin SH, Chen YC, Wu LW and Kuo PL.
Journal Reproduction 146 (1), 63-73 (2013)
Title Variations in PROKR2, but not PROK2, are associated with hypopituitarism and septo-optic dysplasia .
Author McCabe MJ, Gaston-Massuet C, Gregory LC, Alatzoglou KS, Tziaferi V, Sbai O, Rondard P, Masumoto KH, Nagano M, Shigeyoshi Y, Pfeifer M, Hulse T, Buchanan CR, Pitteloud N, Martinez-Barbera JP and Dattani MT.
Journal J. Clin. Endocrinol. Metab. 98 (3), E547-E557 (2013)
Title Expression and regulation of the prokineticins (endocrine gland-derived vascular endothelial growth factor and Bv8) and their receptors in the human endometrium across the menstrual cycle .
Author Battersby S, Critchley HO, Morgan K, Millar RP and Jabbour HN.
Journal J. Clin. Endocrinol. Metab. 89 (5), 2463-2469 (2004)
Title Molecular cloning and characterization of prokineticin receptors .
Author Soga T, Matsumoto Si, Oda T, Saito T, Hiyama H, Takasaki J, Kamohara M, Ohishi T, Matsushime H and Furuichi K.
Journal Biochim. Biophys. Acta 1579 (2-3), 173-179 (2002)
Title Identification and molecular characterization of two closely related G protein-coupled receptors activated by prokineticins/endocrine gland vascular endothelial growth factor .
Author Lin DC, Bullock CM, Ehlert FJ, Chen JL, Tian H and Zhou QY.
Journal J. Biol. Chem. 277 (22), 19276-19280 (2002)
Title The DNA sequence and comparative analysis of human chromosome 20 .
Author Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S and Rogers J.
Journal Nature 414 (6866), 865-871 (2001)
Title Isolated Gonadotropin-Releasing Hormone (GnRH) Deficiency .
Author Buck,C., Balasubramanian,R. and Crowley,W.F.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.