Homo sapiens prokineticin receptor 2 (PROKR2), mRNA.
| RefSeq Version | NM_144773.2, 30581162 |
| Length | 1155 bp |
| Structure | linear |
| Update Date | 24-APR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens prokineticin receptor 2 (PROKR2), mRNA. |
| Product | prokineticin receptor 2 |
| Comment | Summary: Prokineticins are secreted proteins that can promote angiogenesis and induce strong gastrointestinal smooth muscle contraction. The protein encoded by this gene is an integral membrane protein and G protein-coupled receptor for prokineticins. The encoded protein is similar in sequence to GPR73, another G protein-coupled receptor for prokineticins. [provided by RefSeq]. |
| RefSeq | NP_658986.1 |
| CDS | 1..1155 | Exon (1) | 1..458 | Exon (2) | 459..1155 |
| Translation | MAAQNGNTSFTPNFNPPQDHASSLSFNFSYGDYDLPMDEDEDMTKTRTFFAAKIVIGIAL
AGIMLVCGIGNFVFIAALTRYKKLRNLTNLLIANLAISDFLVAIICCPFEMDYYVVRQLS
WEHGHVLCASVNYLRTVSLYVSTNALLAIAIDRYLAIVHPLKPRMNYQTASFLIALVWMV
SILIAIPSAYFATETVLFIVKSQEKIFCGQIWPVDQQLYYKSYFLFIFGVEFVGPVVTMT
LCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPFYGFTIVRDF
FPTVFVKEKHYLTAFYVVECIAMSNSMINTVCFVTVKNNTMKYFKKMMLLHWRPSQRGSK
SSADLDLRTNGVPTTEEVDCIRLK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| 254 | + | a, g | dbSNP:74315418 |
| complement(465) | - | g, a | dbSNP:3746684 |
| 518 | + | g, t | dbSNP:74315416 |
| complement(525) | - | g, c | dbSNP:3746683 |
| complement(585) | - | g, c | dbSNP:3746682 |
| 629 | + | a, g | dbSNP:74315417 |
| complement(802) | - | g, a | dbSNP:78861628 |
| 969 | + | a, g | dbSNP:74315419 |
| complement(991) | - | t, c | dbSNP:117106081 |
| complement(1110) | - | g, a | dbSNP:76049287 |
| complement(1122) | - | t, g | dbSNP:76469093 |
| Gene Symbol | PROKR2 |
| Gene Synonym | dJ680N4.3; GPR73b; GPR73L1; GPRg2; KAL3; PKR2 |
| Chromosome | 20 |
| Locus Map | 20p12.3 |
| All Transcripts | NM_144773 |
| Title | Chlamydia trachomatis infection increases fallopian tube PROKR2 via TLR2 and NFkappaB activation resulting in a microenvironment predisposed to ectopic pregnancy . |
| Author | Shaw,J.L., Wills,G.S., Lee,K.F., Horner,P.J., McClure,M.O., Abrahams,V.M., Wheelhouse,N., Jabbour,H.N., Critchley,H.O., Entrican,G. and Horne,A.W. |
| Journal | Am. J. Pathol. 178 (1), 253-260 (2011) |
| Title | Polymorphisms of endocrine gland-derived vascular endothelial growth factor gene and its receptor genes are associated with recurrent pregnancy loss . |
| Author | Su,M.T., Lin,S.H., Lee,I.W., Chen,Y.C., Hsu,C.C., Pan,H.A. and Kuo,P.L. |
| Journal | Hum. Reprod. 25 (11), 2923-2930 (2010) |
| Title | A large-scale candidate gene association study of age at menarche and age at natural menopause . |
| Author | He,C., Kraft,P., Chasman,D.I., Buring,J.E., Chen,C., Hankinson,S.E., Pare,G., Chanock,S., Ridker,P.M. and Hunter,D.J. |
| Journal | Hum. Genet. 128 (5), 515-527 (2010) |
| Title | PROKR2 is associated with methamphetamine dependence in the Japanese population . |
| Author | Kishi,T., Kitajima,T., Tsunoka,T., Okumura,T., Okochi,T., Kawashima,K., Inada,T., Ujike,H., Yamada,M., Uchimura,N., Sora,I., Iyo,M., Ozaki,N. and Iwata,N. |
| Journal | Prog. Neuropsychopharmacol. Biol. Psychiatry 34 (6), 1033-1036 (2010) |
| Title | Kallmann syndrome caused by mutations in the PROK2 and PROKR2 genes: pathophysiology and genotype-phenotype correlations . |
| Author | Sarfati,J., Dode,C. and Young,J. |
| Journal | Front Horm Res 39, 121-132 (2010) |
| Title | Stable association between G alpha(q) and phospholipase C beta 1 in living cells . |
| Author | Dowal,L., Provitera,P. and Scarlata,S. |
| Journal | J. Biol. Chem. 281 (33), 23999-24014 (2006) |
| Title | Expression and regulation of the prokineticins (endocrine gland-derived vascular endothelial growth factor and Bv8) and their receptors in the human endometrium across the menstrual cycle . |
| Author | Battersby,S., Critchley,H.O., Morgan,K., Millar,R.P. and Jabbour,H.N. |
| Journal | J. Clin. Endocrinol. Metab. 89 (5), 2463-2469 (2004) |
| Title | Molecular cloning and characterization of prokineticin receptors . |
| Author | Soga,T., Matsumoto,S., Oda,T., Saito,T., Hiyama,H., Takasaki,J., Kamohara,M., Ohishi,T., Matsushime,H. and Furuichi,K. |
| Journal | Biochim. Biophys. Acta 1579 (2-3), 173-179 (2002) |
| Title | Identification and molecular characterization of two closely related G protein-coupled receptors activated by prokineticins/endocrine gland vascular endothelial growth factor . |
| Author | Lin,D.C., Bullock,C.M., Ehlert,F.J., Chen,J.L., Tian,H. and Zhou,Q.Y. |
| Journal | J. Biol. Chem. 277 (22), 19276-19280 (2002) |
| Title | The DNA sequence and comparative analysis of human chromosome 20 . |
| Author | Deloukas,P., Matthews,L.H., Ashurst,J., Burton,J., Gilbert,J.G., Jones,M., Stavrides,G., Almeida,J.P., Babbage,A.K., Bagguley,C.L., Bailey,J., Barlow,K.F., Bates,K.N., Beard,L.M., Beare,D.M., Beasley,O.P., Bird,C.P., Blakey,S.E., Bridgeman,A.M., Brown,A.J., Buck,D., Burrill,W., Butler,A.P., Carder,C., Carter,N.P., Chapman,J.C., Clamp,M., Clark,G., Clark,L.N., Clark,S.Y., Clee,C.M., Clegg,S., Cobley,V.E., Collier,R.E., Connor,R., Corby,N.R., Coulson,A., Coville,G.J., Deadman,R., Dhami,P., Dunn,M., Ellington,A.G., Frankland,J.A., Fraser,A., French,L., Garner,P., Grafham,D.V., Griffiths,C., Griffiths,M.N., Gwilliam,R., Hall,R.E., Hammond,S., Harley,J.L., Heath,P.D., Ho,S., Holden,J.L., Howden,P.J., Huckle,E., Hunt,A.R., Hunt,S.E., Jekosch,K., Johnson,C.M., Johnson,D., Kay,M.P., Kimberley,A.M., King,A., Knights,A., Laird,G.K., Lawlor,S., Lehvaslaiho,M.H., Leversha,M., Lloyd,C., Lloyd,D.M., Lovell,J.D., Marsh,V.L., Martin,S.L., McConnachie,L.J., McLay,K., McMurray,A.A., Milne,S., Mistry,D., Moore,M.J., Mullikin,J.C., Nickerson,T., Oliver,K., Parker,A., Patel,R., Pearce,T.A., Peck,A.I., Phillimore,B.J., Prathalingam,S.R., Plumb,R.W., Ramsay,H., Rice,C.M., Ross,M.T., Scott,C.E., Sehra,H.K., Shownkeen,R., Sims,S., Skuce,C.D., Smith,M.L., Soderlund,C., Steward,C.A., Sulston,J.E., Swann,M., Sycamore,N., Taylor,R., Tee,L., Thomas,D.W., Thorpe,A., Tracey,A., Tromans,A.C., Vaudin,M., Wall,M., Wallis,J.M., Whitehead,S.L., Whittaker,P., Willey,D.L., Williams,L., Williams,S.A., Wilming,L., Wray,P.W., Hubbard,T., Durbin,R.M., Bentley,D.R., Beck,S. and Rogers,J. |
| Journal | Nature 414 (6866), 865-871 (2001) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |