• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens prokineticin receptor 2 (PROKR2), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_144773 Homo sapiens prokineticin receptor 2 (PROKR2), mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_144773.2, 30581162
Length 1155 bp
Structure linear
Update Date 18-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens prokineticin receptor 2 (PROKR2), mRNA.
Product prokineticin receptor 2
Comment

Summary: Prokineticins are secreted proteins that can promote angiogenesis and induce strong gastrointestinal smooth muscle contraction. The protein encoded by this gene is an integral membrane protein and G protein-coupled receptor for prokineticins. The encoded protein is similar in sequence to GPR73, another G protein-coupled receptor for prokineticins. [provided by RefSeq, Jul 2008].

RefSeq NP_658986.1
CDS 1..1155
Misc Feature(1)163..225
Misc Feature(2)163..225
Misc Feature(3)226..987
Misc Feature(4)268..330
Misc Feature(5)409..471
Misc Feature(6)514..576
Misc Feature(7)670..732
Misc Feature(8)820..882
Misc Feature(9)940..1002
Exon (1)459..1155
Gene:PROKR2
Gene Synonym:dJ680N4.3; GPR73b; GPR73L1; GPRg2; HH3; KAL3; PKR2
Translation MAAQNGNTSFTPNFNPPQDHASSLSFNFSYGDYDLPMDEDEDMTKTRTFFAAKIVIGIAL AGIMLVCGIGNFVFIAALTRYKKLRNLTNLLIANLAISDFLVAIICCPFEMDYYVVRQLS WEHGHVLCASVNYLRTVSLYVSTNALLAIAIDRYLAIVHPLKPRMNYQTASFLIALVWMV SILIAIPSAYFATETVLFIVKSQEKIFCGQIWPVDQQLYYKSYFLFIFGVEFVGPVVTMT LCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPFYGFTIVRDF FPTVFVKEKHYLTAFYVVECIAMSNSMINTVCFVTVKNNTMKYFKKMMLLHWRPSQRGSK SSADLDLRTNGVPTTEEVDCIRLK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(35)-dbSNP:
complement(35)-g, cdbSNP:147773715
complement(55)-t, cdbSNP:146062524
complement(117)-t, cdbSNP:200262756
complement(150)-g, adbSNP:149123899
complement(151)-t, cdbSNP:144994507
complement(163)-t, cdbSNP:146963803
complement(169)-c, adbSNP:201283126
complement(201)-g, adbSNP:201898089
complement(225)-g, adbSNP:139296723
complement(253)-g, c, adbSNP:141090506
complement(254)-t, g, adbSNP:74315418
complement(256)-t, cdbSNP:140004129
complement(294)-g, adbSNP:146061254
complement(337)-g, adbSNP:202203360
complement(343)-t, cdbSNP:138672528
complement(349)-g, adbSNP:142008002
complement(375)-g, adbSNP:148596437
complement(376)-t, cdbSNP:200048973
complement(381)-g, cdbSNP:189546592
complement(390)-g, adbSNP:144778137
complement(403)-g, adbSNP:149396342
complement(409)-t, cdbSNP:139259742
complement(420)-g, adbSNP:199794008
complement(465)-dbSNP:
complement(465)-g, adbSNP:3746684
complement(466)-t, cdbSNP:200887188
complement(507)-t, cdbSNP:142753046
complement(518)-t, gdbSNP:74315416
complement(525)-g, cdbSNP:3746683
complement(533)-g, cdbSNP:201835496
complement(585)-g, cdbSNP:3746682
complement(597)-g, adbSNP:148066986
complement(604)-t, cdbSNP:200755554
complement(629)-g, adbSNP:74315417
complement(708)-t, cdbSNP:143615891
complement(711)-g, adbSNP:192855237
complement(790)-g, adbSNP:148868355
complement(796)-g, adbSNP:146729363
complement(797)-t, cdbSNP:143647776
complement(802)-g, adbSNP:78861628
complement(809)-t, cdbSNP:146544539
complement(815)-t, gdbSNP:188744190
complement(868)-g, adbSNP:149992595
complement(877)-t, cdbSNP:201311009
complement(889)-t, cdbSNP:139399061
complement(904)-g, adbSNP:199958585
complement(912)-t, cdbSNP:201600683
complement(916)-t, cdbSNP:199696443
complement(943)-g, adbSNP:200449168
complement(963)-g, adbSNP:142257149
complement(969)-g, adbSNP:74315419
complement(991)-t, cdbSNP:117106081
complement(999)-g, adbSNP:138101742
complement(1005)-t, cdbSNP:150381386
complement(1110)-g, adbSNP:76049287
complement(1111)-g, cdbSNP:201023639
complement(1122)-t, gdbSNP:76469093
complement(1154)-c, adbSNP:147311278
Gene SymbolPROKR2
Gene SynonymdJ680N4.3; GPR73b; GPR73L1; GPRg2; HH3; KAL3; PKR2
Chromosome20
Locus Map20p12.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_144773 Homo sapiens prokineticin receptor 2 (PROKR2), mRNA. In-stock $418.00 $369.00 10
Title PROKR2 and PROK2 mutations cause isolated congenital anosmia without gonadotropic deficiency .
Author Moya-Plana,A., Villanueva,C., Laccourreye,O., Bonfils,P. and de Roux,N.
Journal Eur. J. Endocrinol. 168 (1), 31-37 (2012)
Title An ancient founder mutation in PROKR2 impairs human reproduction .
Author Avbelj Stefanija,M., Jeanpierre,M., Sykiotis,G.P., Young,J., Quinton,R., Abreu,A.P., Plummer,L., Au,M.G., Balasubramanian,R., Dwyer,A.A., Florez,J.C., Cheetham,T., Pearce,S.H., Purushothaman,R., Schinzel,A., Pugeat,M., Jacobson-Dickman,E.E., Ten,S., Latronico,A.C., Gusella,J.F., Dode,C., Crowley,W.F. Jr. and Pitteloud,N.
Journal Hum. Mol. Genet. 21 (19), 4314-4324 (2012)
Title Evidence of the importance of the first intracellular loop of prokineticin receptor 2 in receptor function .
Author Abreu,A.P., Noel,S.D., Xu,S., Carroll,R.S., Latronico,A.C. and Kaiser,U.B.
Journal Mol. Endocrinol. 26 (8), 1417-1427 (2012)
Title PROKR2 variants in multiple hypopituitarism with pituitary stalk interruption .
Author Reynaud,R., Jayakody,S.A., Monnier,C., Saveanu,A., Bouligand,J., Guedj,A.M., Simonin,G., Lecomte,P., Barlier,A., Rondard,P., Martinez-Barbera,J.P., Guiochon-Mantel,A. and Brue,T.
Journal J. Clin. Endocrinol. Metab. 97 (6), E1068-E1073 (2012)
Title Genetic overlap in Kallmann syndrome, combined pituitary hormone deficiency, and septo-optic dysplasia .
Author Raivio,T., Avbelj,M., McCabe,M.J., Romero,C.J., Dwyer,A.A., Tommiska,J., Sykiotis,G.P., Gregory,L.C., Diaczok,D., Tziaferi,V., Elting,M.W., Padidela,R., Plummer,L., Martin,C., Feng,B., Zhang,C., Zhou,Q.Y., Chen,H., Mohammadi,M., Quinton,R., Sidis,Y., Radovick,S., Dattani,M.T. and Pitteloud,N.
Journal J. Clin. Endocrinol. Metab. 97 (4), E694-E699 (2012)
Title Stable association between G alpha(q) and phospholipase C beta 1 in living cells .
Author Dowal,L., Provitera,P. and Scarlata,S.
Journal J. Biol. Chem. 281 (33), 23999-24014 (2006)
Title Expression and regulation of the prokineticins (endocrine gland-derived vascular endothelial growth factor and Bv8) and their receptors in the human endometrium across the menstrual cycle .
Author Battersby,S., Critchley,H.O., Morgan,K., Millar,R.P. and Jabbour,H.N.
Journal J. Clin. Endocrinol. Metab. 89 (5), 2463-2469 (2004)
Title Molecular cloning and characterization of prokineticin receptors .
Author Soga,T., Matsumoto,Si., Oda,T., Saito,T., Hiyama,H., Takasaki,J., Kamohara,M., Ohishi,T., Matsushime,H. and Furuichi,K.
Journal Biochim. Biophys. Acta 1579 (2-3), 173-179 (2002)
Title Identification and molecular characterization of two closely related G protein-coupled receptors activated by prokineticins/endocrine gland vascular endothelial growth factor .
Author Lin,D.C., Bullock,C.M., Ehlert,F.J., Chen,J.L., Tian,H. and Zhou,Q.Y.
Journal J. Biol. Chem. 277 (22), 19276-19280 (2002)
Title The DNA sequence and comparative analysis of human chromosome 20 .
Author Deloukas,P., Matthews,L.H., Ashurst,J., Burton,J., Gilbert,J.G., Jones,M., Stavrides,G., Almeida,J.P., Babbage,A.K., Bagguley,C.L., Bailey,J., Barlow,K.F., Bates,K.N., Beard,L.M., Beare,D.M., Beasley,O.P., Bird,C.P., Blakey,S.E., Bridgeman,A.M., Brown,A.J., Buck,D., Burrill,W., Butler,A.P., Carder,C., Carter,N.P., Chapman,J.C., Clamp,M., Clark,G., Clark,L.N., Clark,S.Y., Clee,C.M., Clegg,S., Cobley,V.E., Collier,R.E., Connor,R., Corby,N.R., Coulson,A., Coville,G.J., Deadman,R., Dhami,P., Dunn,M., Ellington,A.G., Frankland,J.A., Fraser,A., French,L., Garner,P., Grafham,D.V., Griffiths,C., Griffiths,M.N., Gwilliam,R., Hall,R.E., Hammond,S., Harley,J.L., Heath,P.D., Ho,S., Holden,J.L., Howden,P.J., Huckle,E., Hunt,A.R., Hunt,S.E., Jekosch,K., Johnson,C.M., Johnson,D., Kay,M.P., Kimberley,A.M., King,A., Knights,A., Laird,G.K., Lawlor,S., Lehvaslaiho,M.H., Leversha,M., Lloyd,C., Lloyd,D.M., Lovell,J.D., Marsh,V.L., Martin,S.L., McConnachie,L.J., McLay,K., McMurray,A.A., Milne,S., Mistry,D., Moore,M.J., Mullikin,J.C., Nickerson,T., Oliver,K., Parker,A., Patel,R., Pearce,T.A., Peck,A.I., Phillimore,B.J., Prathalingam,S.R., Plumb,R.W., Ramsay,H., Rice,C.M., Ross,M.T., Scott,C.E., Sehra,H.K., Shownkeen,R., Sims,S., Skuce,C.D., Smith,M.L., Soderlund,C., Steward,C.A., Sulston,J.E., Swann,M., Sycamore,N., Taylor,R., Tee,L., Thomas,D.W., Thorpe,A., Tracey,A., Tromans,A.C., Vaudin,M., Wall,M., Wallis,J.M., Whitehead,S.L., Whittaker,P., Willey,D.L., Williams,L., Williams,S.A., Wilming,L., Wray,P.W., Hubbard,T., Durbin,R.M., Bentley,D.R., Beck,S. and Rogers,J.
Journal Nature 414 (6866), 865-871 (2001)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.