• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens kinesin family member 6 (KIF6), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu06448 Homo sapiens kinesin family member 6 (KIF6), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu06448C Homo sapiens kinesin family member 6 (KIF6), transcript variant 1, mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_145027.4, 157502183
Length 2445 bp
Structure linear
Update Date 26-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens kinesin family member 6 (KIF6), transcript variant 1, mRNA.
Product kinesin-like protein KIF6 isoform 1
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK131471.1, BX649045.1, AL832634.2, AL136087.12 and AK123217.1. On Sep 25, 2007 this sequence version replaced gi:47271465.


Transcript Variant: This variant (1) represents the longest transcript and encodes the longest isoform (1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_659464.3
CDS 96..2540
Misc Feature(1)6..8
Misc Feature(2)6..8
Misc Feature(3)108..1124
Misc Feature(4)108..1124
Misc Feature(5)order(132..134,384..386,393..395,399..410,843..845)
Misc Feature(6)135..1523
Misc Feature(7)order(987..989,996..998,1005..1007)
Exon (1)1..161
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (2)162..271
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (3)272..346
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (4)347..494
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (5)495..604
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (6)605..734
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (7)735..941
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (8)942..1085
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (9)1086..1172
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (10)1173..1276
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (11)1277..1382
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (12)1383..1521
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (13)1522..1740
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (14)1741..1849
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (15)1850..1905
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (16)1906..1956
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (17)1957..2041
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (18)2042..2177
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (19)2178..2275
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (20)2276..2326
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (21)2327..2416
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (22)2417..2523
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (23)2524..3972
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Translation MVKQTIQIFARVKPPVRKHQQGIYSIDEDEKLIPSLEIILPRDLADGFVNNKRESYKFKF QRIFDQDANQETVFENIAKPVAGSVLAGYNGTIFAYGQTGSGKTFTITGGAERYSDRGII PRTLSYIFEQLQKDSSKIYTTHISYLEIYNECGYDLLDPRHEASSLEDLPKVTILEDPDQ NIHLKNLTLHQATTEEEALNLLFLGDTNRMIAETPMNQASTRSHCIFTIHLSSKEPGSAT VRHAKLHLVDLAGSERVAKTGVGGHLLTEAKYINLSLHYLEQVIIALSEKHRSHIPYRNS MMTSVLRDSLGGNCMTTMIATLSLEKRNLDESISTCRFAQRVALIKNEAVLNEEINPRLV IKRLQKEIQELKDELAMVTGEQRTEALTEAELLQLEKLITSFLEDQDSDSRLEVGADMRK VHHCFHHLKKLLNDKKILENNTVSSESKDQDCQEPLKEEEYRKLRDILKQRDNEINILVN MLKKEKKKAQEALHLAGMDRREFRQSQSPPFRLGNPEEGQRMRLSSAPSQAQDFSILGKR SSLLHKKIGMREEMSLGCQEAFEIFKRDHADSVTIDDNKQILKQRFSEAKALGESINEAR SKIGHLKEEITQRHIQQVALGISENMAVPLMPDQQEEKLRSQLEEEKRRYKTMFTRLKAL KVEIEHLQLLMDKAKVKLQKEFEVWWAEEATNLQVNSPAVNSLDHTKPFLQTSDSQHEWS QLLSNKSSGGWEVQDQGTGRFDVCDVNARKILPSPCPSPHSQKQSSTSTPLEDSIPKRPV SSIPLTGDSQTDSDIIAFIKARQSILQKQCLGSN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(52)-g, adbSNP:372703112
complement(125)-c, adbSNP:369226336
complement(149)-g, cdbSNP:201056107
complement(161)-t, cdbSNP:148514295
complement(193)-dbSNP:
complement(193)-g, adbSNP:372712740
complement(198)-t, cdbSNP:114269617
complement(203)-t, cdbSNP:149379197
complement(215)-t, cdbSNP:34016507
complement(218)-t, adbSNP:368784099
complement(227)-t, cdbSNP:147204228
complement(240)-g, cdbSNP:374296037
complement(282)-dbSNP:
complement(282)-t, cdbSNP:34059104
complement(312)-t, cdbSNP:150291005
complement(384)-dbSNP:
complement(384)-t, cdbSNP:374379650
complement(397)-t, cdbSNP:148196382
complement(398)-g, adbSNP:371477997
complement(424)-g, cdbSNP:143055453
complement(426)-t, cdbSNP:377073481
complement(433)-t, cdbSNP:149685088
complement(512)-dbSNP:
complement(512)-g, adbSNP:370077829
complement(519)-g, adbSNP:375857820
complement(629)-dbSNP:
complement(629)-g, adbSNP:375216743
complement(669)-t, cdbSNP:200974739
complement(683)-t, cdbSNP:367771821
complement(687)-t, cdbSNP:138958639
complement(726)-t, adbSNP:145128477
complement(748)-dbSNP:
complement(748)-t, cdbSNP:200617438
complement(760)-t, cdbSNP:141406865
complement(767)-g, adbSNP:370813030
complement(779)-g, adbSNP:377434082
complement(783)-t, gdbSNP:199511584
complement(797)-t, cdbSNP:374567626
complement(807)-g, adbSNP:113952912
complement(816)-t, cdbSNP:145393659
complement(819)-g, cdbSNP:367544865
complement(825)-t, cdbSNP:370061815
complement(828)-t, cdbSNP:375645276
complement(884)-g, cdbSNP:192086315
complement(897)-t, gdbSNP:372620767
complement(907)-t, cdbSNP:150066437
complement(908)-t, cdbSNP:7738892
complement(912)-t, cdbSNP:151248135
complement(936)-c, adbSNP:369417540
complement(953)-dbSNP:
complement(953)-g, adbSNP:202065281
complement(964)-t, cdbSNP:183216278
complement(996)-t, cdbSNP:36103565
complement(1024)-t, adbSNP:140857180
complement(1027)-t, cdbSNP:138804732
complement(1061)-g, cdbSNP:146022097
complement(1077)-t, adbSNP:145259254
complement(1088)-dbSNP:
complement(1088)-t, cdbSNP:139687906
complement(1092)-t, cdbSNP:144582024
complement(1094)-t, cdbSNP:370978090
complement(1116)-g, adbSNP:149324986
complement(1117)-t, c, adbSNP:376939652
complement(1147)-c, adbSNP:138380164
complement(1154)-t, g, cdbSNP:150520804
complement(1169)-t, cdbSNP:142441909
complement(1182)-dbSNP:
complement(1182)-g, adbSNP:142944273
complement(1219)-t, g, adbSNP:201058110
complement(1251)-t, cdbSNP:200447795
complement(1254)-g, adbSNP:145371675
complement(1258)-g, adbSNP:370862448
complement(1291)-dbSNP:
complement(1291)-g, adbSNP:369914344
complement(1340)-g, adbSNP:148142040
complement(1341)-t, cdbSNP:377245127
complement(1342)-g, adbSNP:201860401
complement(1348)-g, adbSNP:369041236
complement(1421)-dbSNP:
complement(1421)-t, cdbSNP:143791545
complement(1422)-t, cdbSNP:35723069
complement(1426)-g, adbSNP:200500397
complement(1488)-g, adbSNP:149018745
complement(1514)-g, adbSNP:139539539
complement(1515)-t, cdbSNP:191227648
complement(1525)-dbSNP:
complement(1525)-g, adbSNP:199948803
complement(1570)-t, gdbSNP:144652394
complement(1572)-g, adbSNP:377508148
complement(1596)-g, adbSNP:201826611
complement(1623)-g, adbSNP:142407346
complement(1624)-g, cdbSNP:370276826
1630+a, gdbSNP:2273063
complement(1632)-g, cdbSNP:374476675
complement(1648)-t, gdbSNP:370484204
complement(1659)-t, adbSNP:114951361
complement(1662)-t, g, adbSNP:145150015
complement(1681)-g, adbSNP:199674587
complement(1687)-t, gdbSNP:371002741
complement(1707)-g, cdbSNP:142216439
complement(1731)-t, cdbSNP:200506835
complement(1747)-dbSNP:
complement(1747)-t, cdbSNP:61748649
complement(1772)-t, cdbSNP:201410117
complement(1785)-t, cdbSNP:374888397
complement(1829)-g, adbSNP:61757646
complement(1870)-dbSNP:
complement(1870)-g, adbSNP:200299206
complement(1886)-g, adbSNP:183642030
complement(1892)-t, cdbSNP:111841262
complement(1905)-t, cdbSNP:142325164
complement(1932)-dbSNP:
complement(1932)-g, adbSNP:139112928
complement(1935)-t, gdbSNP:202145144
complement(1940)-t, cdbSNP:375315494
complement(1943)-c, adbSNP:201395914
complement(1953)-g, adbSNP:35249324
complement(1955)-t, cdbSNP:141639074
complement(1964)-dbSNP:
complement(1964)-t, cdbSNP:371066947
complement(1971)-t, cdbSNP:138268487
complement(2014)-t, cdbSNP:188790180
complement(2029)-t, cdbSNP:377571126
complement(2033)-t, cdbSNP:183896368
complement(2041)-t, cdbSNP:372459640
complement(2061)-dbSNP:
complement(2061)-t, gdbSNP:150466485
complement(2062)-t, cdbSNP:141566437
complement(2086)-t, adbSNP:148383716
complement(2089)-t, cdbSNP:142999075
complement(2106)-t, cdbSNP:368687338
complement(2171)-g, cdbSNP:142324072
complement(2187)-dbSNP:
complement(2187)-g, adbSNP:375678835
complement(2212)-g, cdbSNP:201592417
complement(2217)-t, gdbSNP:372001923
complement(2243)-c, adbSNP:199509937
2250+c, tdbSNP:20455
complement(2256)-g, adbSNP:149250289
complement(2349)-dbSNP:
complement(2349)-g, adbSNP:200351411
complement(2365)-t, gdbSNP:145557784
complement(2396)-g, adbSNP:375569188
complement(2437)-dbSNP:
complement(2437)-g, adbSNP:180943940
complement(2438)-t, cdbSNP:34836492
complement(2454)-t, cdbSNP:139582255
complement(2467)-g, adbSNP:373037080
complement(2473)-g, adbSNP:202222855
complement(2474)-t, cdbSNP:143657366
complement(2484)-t, cdbSNP:144156709
complement(2498)-g, adbSNP:371147357
complement(2603)-dbSNP:
complement(2603)-t, cdbSNP:368284457
2636+c, tdbSNP:16891957
complement(2637)-c, adbSNP:3734621
complement(2641)-t, gdbSNP:145320572
2700+a, cdbSNP:139767998
complement(2745)-t, cdbSNP:72858477
complement(2836)-t, adbSNP:74659777
complement(2840)-t, cdbSNP:371244658
complement(2882)-g, adbSNP:11756686
complement(2951)-g, adbSNP:368168479
complement(2970)-g, adbSNP:116706958
complement(2978)-t, cdbSNP:3823213
complement(3008)-t, cdbSNP:11758639
complement(3035)-g, adbSNP:73731795
complement(3041)-t, cdbSNP:10947807
complement(3093)-g, adbSNP:6904582
complement(3205)-t, cdbSNP:117842239
complement(3254)-g, adbSNP:9462531
complement(3254)-g, adbSNP:386622761
complement(3479)-g, adbSNP:147813134
complement(3495)-g, cdbSNP:142173734
complement(3506)-t, cdbSNP:200765599
complement(3508)-, tdbSNP:139304973
complement(3541)-t, cdbSNP:115025619
complement(3566)-g, adbSNP:16891944
complement(3621)-c, adbSNP:190137715
complement(3682)-t, adbSNP:72858469
complement(3709)-g, adbSNP:144747535
complement(3910)-t, cdbSNP:114582772
complement(3972)-t, cdbSNP:72858468
Gene SymbolKIF6
Gene SynonymC6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Chromosome6
Locus Map6p21.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_145027 Homo sapiens kinesin family member 6 (KIF6), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_145027 Homo sapiens kinesin family member 6 (KIF6), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_145027 Homo sapiens kinesin family member 6 (KIF6), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_145027 Homo sapiens kinesin family member 6 (KIF6), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_145027 Homo sapiens kinesin family member 6 (KIF6), transcript variant 1, mRNA. On-demand $279.00 12-14
Title KLF6 loss of function in human prostate cancer progression is implicated in resistance to androgen deprivation .
Author Liu X, Gomez-Pinillos A, Loder C, Carrillo-de Santa Pau E, Qiao R, Unger PD, Kurek R, Oddoux C, Melamed J, Gallagher RE, Mandeli J and Ferrari AC.
Journal Am. J. Pathol. 181 (3), 1007-1016 (2012)
Title Genome-wide association study of antibody response to smallpox vaccine .
Author Ovsyannikova IG, Kennedy RB, O'Byrne M, Jacobson RM, Pankratz VS and Poland GA.
Journal Vaccine 30 (28), 4182-4189 (2012)
Title Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population .
Author Comuzzie AG, Cole SA, Laston SL, Voruganti VS, Haack K, Gibbs RA and Butte NF.
Journal PLoS ONE 7 (12), E51954 (2012)
Title Meta-analyses of KIF6 Trp719Arg in coronary heart disease and statin therapeutic effect .
Author Peng P, Lian J, Huang RS, Xu L, Huang Y, Ba Y, Yang X, Huang X, Dong C, Zhang L, Ye M, Zhou J and Duan S.
Journal PLoS ONE 7 (12), E50126 (2012)
Title Association of KIF6 variant with lipid level and angiographic coronary artery disease events risk in the Han Chinese population .
Author Wu G, Li GB and Dai B.
Journal Molecules 17 (9), 11269-11280 (2012)
Title A kinesin family member 6 variant is associated with coronary heart disease in the Women's Health Study .
Author Shiffman D, Chasman DI, Zee RY, Iakoubova OA, Louie JZ, Devlin JJ and Ridker PM.
Journal J. Am. Coll. Cardiol. 51 (4), 444-448 (2008)
Title Association of the Trp719Arg polymorphism in kinesin-like protein 6 with myocardial infarction and coronary heart disease in 2 prospective trials: the CARE and WOSCOPS trials .
Author Iakoubova OA, Tong CH, Rowland CM, Kirchgessner TG, Young BA, Arellano AR, Shiffman D, Sabatine MS, Campos H, Packard CJ, Pfeffer MA, White TJ, Braunwald E, Shepherd J, Devlin JJ and Sacks FM.
Journal J. Am. Coll. Cardiol. 51 (4), 435-443 (2008)
Title Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study .
Author Shiffman D, O'Meara ES, Bare LA, Rowland CM, Louie JZ, Arellano AR, Lumley T, Rice K, Iakoubova O, Luke MM, Young BA, Malloy MJ, Kane JP, Ellis SG, Tracy RP, Devlin JJ and Psaty BM.
Journal Arterioscler. Thromb. Vasc. Biol. 28 (1), 173-179 (2008)
Title Five common gene variants identify elevated genetic risk for coronary heart disease .
Author Bare LA, Morrison AC, Rowland CM, Shiffman D, Luke MM, Iakoubova OA, Kane JP, Malloy MJ, Ellis SG, Pankow JS, Willerson JT, Devlin
Journal Genet. Med. 9 (10), 682-689 (2007)
Title The DNA sequence and analysis of human chromosome 6 .
Author Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J and Beck S.
Journal Nature 425 (6960), 805-811 (2003)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.