• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens kinesin family member 6 (KIF6), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_145027 Homo sapiens kinesin family member 6 (KIF6), mRNA. GenEZ ORF Cloning On-demand $899.00 20

*Business Day

Related Services

RefSeq Version NM_145027.4, 157502183
Length 3972 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens kinesin family member 6 (KIF6), mRNA.
Product kinesin-like protein KIF6
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK131471.1, BX649045.1, AL832634.2, AL136087.12 and AK123217.1. On Sep 25, 2007 this sequence version replaced gi:47271465.

RefSeq NP_659464.3
CDS 96..2540
Misc Feature(1)6..8
Misc Feature(2)6..8
Misc Feature(3)108..1124
Misc Feature(4)108..1124
Misc Feature(5)111..1151
Misc Feature(6)order(132..134,384..386,393..395,399..410,843..845)
Misc Feature(7)order(987..989,996..998,1005..1007)
Exon (1)1..161
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (2)162..271
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (3)272..346
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (4)347..494
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (5)495..604
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (6)605..734
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (7)735..941
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (8)942..1085
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (9)1086..1172
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (10)1173..1276
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (11)1277..1382
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (12)1383..1521
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (13)1522..1740
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (14)1741..1849
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (15)1850..1905
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (16)1906..1956
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (17)1957..2041
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (18)2042..2177
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (19)2178..2275
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (20)2276..2326
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (21)2327..2416
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (22)2417..2523
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Exon (23)2524..3972
Gene:KIF6
Gene Synonym:C6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Translation MVKQTIQIFARVKPPVRKHQQGIYSIDEDEKLIPSLEIILPRDLADGFVNNKRESYKFKF QRIFDQDANQETVFENIAKPVAGSVLAGYNGTIFAYGQTGSGKTFTITGGAERYSDRGII PRTLSYIFEQLQKDSSKIYTTHISYLEIYNECGYDLLDPRHEASSLEDLPKVTILEDPDQ NIHLKNLTLHQATTEEEALNLLFLGDTNRMIAETPMNQASTRSHCIFTIHLSSKEPGSAT VRHAKLHLVDLAGSERVAKTGVGGHLLTEAKYINLSLHYLEQVIIALSEKHRSHIPYRNS MMTSVLRDSLGGNCMTTMIATLSLEKRNLDESISTCRFAQRVALIKNEAVLNEEINPRLV IKRLQKEIQELKDELAMVTGEQRTEALTEAELLQLEKLITSFLEDQDSDSRLEVGADMRK VHHCFHHLKKLLNDKKILENNTVSSESKDQDCQEPLKEEEYRKLRDILKQRDNEINILVN MLKKEKKKAQEALHLAGMDRREFRQSQSPPFRLGNPEEGQRMRLSSAPSQAQDFSILGKR SSLLHKKIGMREEMSLGCQEAFEIFKRDHADSVTIDDNKQILKQRFSEAKALGESINEAR SKIGHLKEEITQRHIQQVALGISENMAVPLMPDQQEEKLRSQLEEEKRRYKTMFTRLKAL KVEIEHLQLLMDKAKVKLQKEFEVWWAEEATNLQVNSPAVNSLDHTKPFLQTSDSQHEWS QLLSNKSSGGWEVQDQGTGRFDVCDVNARKILPSPCPSPHSQKQSSTSTPLEDSIPKRPV SSIPLTGDSQTDSDIIAFIKARQSILQKQCLGSN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(149)-g, cdbSNP:201056107
complement(161)-t, cdbSNP:148514295
complement(198)-dbSNP:
complement(198)-t, cdbSNP:114269617
complement(203)-t, cdbSNP:149379197
complement(215)-t, cdbSNP:34016507
complement(227)-t, cdbSNP:147204228
complement(252)-t, gdbSNP:143721786
complement(282)-dbSNP:
complement(282)-t, cdbSNP:34059104
complement(312)-t, cdbSNP:150291005
complement(397)-dbSNP:
complement(397)-t, cdbSNP:148196382
complement(424)-g, cdbSNP:143055453
complement(433)-t, cdbSNP:149685088
complement(669)-dbSNP:
complement(669)-t, cdbSNP:200974739
complement(687)-t, cdbSNP:138958639
complement(726)-t, c, adbSNP:145128477
complement(748)-dbSNP:
complement(748)-t, cdbSNP:200617438
complement(760)-t, cdbSNP:141406865
complement(783)-t, gdbSNP:199511584
complement(807)-g, adbSNP:113952912
complement(816)-t, cdbSNP:145393659
complement(884)-g, cdbSNP:192086315
complement(907)-t, cdbSNP:150066437
complement(908)-t, cdbSNP:7738892
complement(912)-t, cdbSNP:151248135
complement(953)-dbSNP:
complement(953)-g, adbSNP:202065281
complement(964)-t, cdbSNP:183216278
complement(996)-t, cdbSNP:36103565
complement(1024)-t, adbSNP:140857180
complement(1027)-t, cdbSNP:138804732
complement(1061)-g, cdbSNP:146022097
complement(1077)-t, adbSNP:145259254
complement(1088)-dbSNP:
complement(1088)-t, cdbSNP:139687906
complement(1092)-t, cdbSNP:144582024
complement(1116)-g, adbSNP:149324986
complement(1147)-c, adbSNP:138380164
complement(1154)-t, g, cdbSNP:150520804
complement(1169)-t, cdbSNP:142441909
complement(1182)-dbSNP:
complement(1182)-g, adbSNP:142944273
complement(1219)-g, adbSNP:201058110
complement(1251)-t, cdbSNP:200447795
complement(1254)-g, adbSNP:145371675
complement(1340)-dbSNP:
complement(1340)-g, adbSNP:148142040
complement(1342)-g, adbSNP:201860401
complement(1421)-dbSNP:
complement(1421)-t, cdbSNP:143791545
complement(1422)-t, cdbSNP:35723069
complement(1426)-g, adbSNP:200500397
complement(1488)-g, adbSNP:149018745
complement(1514)-g, adbSNP:139539539
complement(1515)-t, cdbSNP:191227648
complement(1525)-dbSNP:
complement(1525)-g, adbSNP:199948803
complement(1570)-t, gdbSNP:144652394
complement(1596)-g, adbSNP:201826611
complement(1623)-g, adbSNP:142407346
complement(1630)-g, adbSNP:2273063
complement(1659)-t, adbSNP:114951361
complement(1662)-t, g, adbSNP:145150015
complement(1681)-g, adbSNP:199674587
complement(1682)-t, cdbSNP:150784073
complement(1707)-g, cdbSNP:142216439
complement(1731)-t, cdbSNP:200506835
complement(1747)-dbSNP:
complement(1747)-t, cdbSNP:61748649
complement(1772)-t, cdbSNP:201410117
complement(1829)-g, adbSNP:61757646
complement(1870)-dbSNP:
complement(1870)-g, adbSNP:200299206
complement(1886)-g, adbSNP:183642030
complement(1892)-t, cdbSNP:111841262
complement(1905)-t, cdbSNP:142325164
complement(1932)-dbSNP:
complement(1932)-g, adbSNP:139112928
complement(1935)-t, gdbSNP:202145144
complement(1943)-c, adbSNP:201395914
complement(1953)-g, adbSNP:35249324
complement(1955)-t, cdbSNP:141639074
complement(1971)-dbSNP:
complement(1971)-t, cdbSNP:138268487
complement(2014)-t, cdbSNP:188790180
complement(2033)-t, cdbSNP:183896368
complement(2061)-dbSNP:
complement(2061)-g, adbSNP:150466485
complement(2062)-t, cdbSNP:141566437
complement(2086)-t, adbSNP:148383716
complement(2089)-t, cdbSNP:142999075
complement(2171)-g, cdbSNP:142324072
complement(2212)-dbSNP:
complement(2212)-g, cdbSNP:201592417
complement(2243)-c, adbSNP:199509937
complement(2250)-t, cdbSNP:20455
complement(2256)-g, c, adbSNP:149250289
complement(2349)-dbSNP:
complement(2349)-g, adbSNP:200351411
complement(2365)-t, gdbSNP:145557784
complement(2437)-dbSNP:
complement(2437)-g, adbSNP:180943940
complement(2438)-t, cdbSNP:34836492
complement(2454)-t, cdbSNP:139582255
complement(2473)-g, adbSNP:202222855
complement(2474)-t, cdbSNP:143657366
complement(2484)-t, cdbSNP:144156709
complement(2636)-dbSNP:
complement(2636)-t, cdbSNP:16891957
complement(2637)-c, adbSNP:3734621
complement(2641)-t, gdbSNP:145320572
complement(2700)-c, adbSNP:139767998
complement(2745)-t, cdbSNP:72858477
complement(2836)-t, adbSNP:74659777
complement(2882)-g, adbSNP:11756686
complement(2970)-g, adbSNP:116706958
complement(2978)-t, cdbSNP:3823213
complement(3008)-t, cdbSNP:11758639
complement(3035)-g, adbSNP:73731795
complement(3041)-t, cdbSNP:10947807
complement(3093)-g, adbSNP:6904582
complement(3205)-t, cdbSNP:117842239
complement(3254)-g, adbSNP:9462531
complement(3479)-g, adbSNP:147813134
complement(3495)-g, cdbSNP:142173734
complement(3506)-t, cdbSNP:200765599
complement(3508)-, tdbSNP:139304973
complement(3541)-t, cdbSNP:115025619
complement(3566)-g, adbSNP:16891944
complement(3621)-c, adbSNP:190137715
complement(3682)-t, adbSNP:72858469
complement(3709)-g, adbSNP:144747535
complement(3910)-t, cdbSNP:114582772
complement(3972)-t, cdbSNP:72858468
Gene SymbolKIF6
Gene SynonymC6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1
Chromosome6
Locus Map6p21.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_145027 Homo sapiens kinesin family member 6 (KIF6), mRNA. On-demand $899.00 20
Title KLF6 loss of function in human prostate cancer progression is implicated in resistance to androgen deprivation .
Author Liu,X., Gomez-Pinillos,A., Loder,C., Carrillo-de Santa Pau,E., Qiao,R., Unger,P.D., Kurek,R., Oddoux,C., Melamed,J., Gallagher,R.E., Mandeli,J. and Ferrari,A.C.
Journal Am. J. Pathol. 181 (3), 1007-1016 (2012)
Title Genome-wide association study of antibody response to smallpox vaccine .
Author Ovsyannikova,I.G., Kennedy,R.B., O'Byrne,M., Jacobson,R.M., Pankratz,V.S. and Poland,G.A.
Journal Vaccine 30 (28), 4182-4189 (2012)
Title KIF6, LPA, TAS2R50, and VAMP8 genetic variation, low density lipoprotein cholesterol lowering response to pravastatin, and heart disease risk reduction in the elderly .
Author Akao,H., Polisecki,E., Kajinami,K., Trompet,S., Robertson,M., Ford,I., Jukema,J.W., de Craen,A.J., Westendorp,R.G., Shepherd,J., Packard,C., Buckley,B.M. and Schaefer,E.J.
Journal Atherosclerosis 220 (2), 456-462 (2012)
Title Association of KIF6 variant with lipid level and angiographic coronary artery disease events risk in the Han Chinese population .
Author Wu,G., Li,G.B. and Dai,B.
Journal Molecules 17 (9), 11269-11280 (2012)
Title A common KIF6 polymorphism increases vulnerability to low-density lipoprotein cholesterol: two meta-analyses and a meta-regression analysis .
Author Ference,B.A., Yoo,W., Flack,J.M. and Clarke,M.
Journal PLoS ONE 6 (12), E28834 (2011)
Title A kinesin family member 6 variant is associated with coronary heart disease in the Women's Health Study .
Author Shiffman,D., Chasman,D.I., Zee,R.Y., Iakoubova,O.A., Louie,J.Z., Devlin,J.J. and Ridker,P.M.
Journal J. Am. Coll. Cardiol. 51 (4), 444-448 (2008)
Title Association of the Trp719Arg polymorphism in kinesin-like protein 6 with myocardial infarction and coronary heart disease in 2 prospective trials: the CARE and WOSCOPS trials .
Author Iakoubova,O.A., Tong,C.H., Rowland,C.M., Kirchgessner,T.G., Young,B.A., Arellano,A.R., Shiffman,D., Sabatine,M.S., Campos,H., Packard,C.J., Pfeffer,M.A., White,T.J., Braunwald,E., Shepherd,J., Devlin,J.J. and Sacks,F.M.
Journal J. Am. Coll. Cardiol. 51 (4), 435-443 (2008)
Title Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study .
Author Shiffman,D., O'Meara,E.S., Bare,L.A., Rowland,C.M., Louie,J.Z., Arellano,A.R., Lumley,T., Rice,K., Iakoubova,O., Luke,M.M., Young,B.A., Malloy,M.J., Kane,J.P., Ellis,S.G., Tracy,R.P., Devlin,J.J. and Psaty,B.M.
Journal Arterioscler. Thromb. Vasc. Biol. 28 (1), 173-179 (2008)
Title Five common gene variants identify elevated genetic risk for coronary heart disease .
Author Bare,L.A., Morrison,A.C., Rowland,C.M., Shiffman,D., Luke,M.M., Iakoubova,O.A., Kane,J.P., Malloy,M.J., Ellis,S.G., Pankow,J.S., Willerson,J.T., Devlin,J.J. and Boerwinkle,E.
Journal Genet. Med. 9 (10), 682-689 (2007)
Title The DNA sequence and analysis of human chromosome 6 .
Author Mungall,A.J., Palmer,S.A., Sims,S.K., Edwards,C.A., Ashurst,J.L., Wilming,L., Jones,M.C., Horton,R., Hunt,S.E., Scott,C.E., Gilbert,J.G., Clamp,M.E., Bethel,G., Milne,S., Ainscough,R., Almeida,J.P., Ambrose,K.D., Andrews,T.D., Ashwell,R.I., Babbage,A.K., Bagguley,C.L., Bailey,J., Banerjee,R., Barker,D.J., Barlow,K.F., Bates,K., Beare,D.M., Beasley,H., Beasley,O., Bird,C.P., Blakey,S., Bray-Allen,S., Brook,J., Brown,A.J., Brown,J.Y., Burford,D.C., Burrill,W., Burton,J., Carder,C., Carter,N.P., Chapman,J.C., Clark,S.Y., Clark,G., Clee,C.M., Clegg,S., Cobley,V., Collier,R.E., Collins,J.E., Colman,L.K., Corby,N.R., Coville,G.J., Culley,K.M., Dhami,P., Davies,J., Dunn,M., Earthrowl,M.E., Ellington,A.E., Evans,K.A., Faulkner,L., Francis,M.D., Frankish,A., Frankland,J., French,L., Garner,P., Garnett,J., Ghori,M.J., Gilby,L.M., Gillson,C.J., Glithero,R.J., Grafham,D.V., Grant,M., Gribble,S., Griffiths,C., Griffiths,M., Hall,R., Halls,K.S., Hammond,S., Harley,J.L., Hart,E.A., Heath,P.D., Heathcott,R., Holmes,S.J., Howden,P.J., Howe,K.L., Howell,G.R., Huckle,E., Humphray,S.J., Humphries,M.D., Hunt,A.R., Johnson,C.M., Joy,A.A., Kay,M., Keenan,S.J., Kimberley,A.M., King,A., Laird,G.K., Langford,C., Lawlor,S., Leongamornlert,D.A., Leversha,M., Lloyd,C.R., Lloyd,D.M., Loveland,J.E., Lovell,J., Martin,S., Mashreghi-Mohammadi,M., Maslen,G.L., Matthews,L., McCann,O.T., McLaren,S.J., McLay,K., McMurray,A., Moore,M.J., Mullikin,J.C., Niblett,D., Nickerson,T., Novik,K.L., Oliver,K., Overton-Larty,E.K., Parker,A., Patel,R., Pearce,A.V., Peck,A.I., Phillimore,B., Phillips,S., Plumb,R.W., Porter,K.M., Ramsey,Y., Ranby,S.A., Rice,C.M., Ross,M.T., Searle,S.M., Sehra,H.K., Sheridan,E., Skuce,C.D., Smith,S., Smith,M., Spraggon,L., Squares,S.L., Steward,C.A., Sycamore,N., Tamlyn-Hall,G., Tester,J., Theaker,A.J., Thomas,D.W., Thorpe,A., Tracey,A., Tromans,A., Tubby,B., Wall,M., Wallis,J.M., West,A.P., White,S.S., Whitehead,S.L., Whittaker,H., Wild,A., Willey,D.J., Wilmer,T.E., Wood,J.M., Wray,P.W., Wyatt,J.C., Young,L., Younger,R.M., Bentley,D.R., Coulson,A., Durbin,R., Hubbard,T., Sulston,J.E., Dunham,I., Rogers,J. and Beck,S.
Journal Nature 425 (6960), 805-811 (2003)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.