• THAT   AND
  • THAT   AND


Homo sapiens kinesin family member 6 (KIF6), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_145027 Homo sapiens kinesin family member 6 (KIF6), mRNA. Full Lenth $1390.20
ORF Sequence $709.05


RefSeq Version NM_145027.4, 157502183
Length 3972 bp
Structure linear
Update Date 22-APR-2011
Organism Homo sapiens (human)
Definition Homo sapiens kinesin family member 6 (KIF6), mRNA.
Product kinesin-like protein KIF6
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK131471.1, BX649045.1, AL832634.2, AL136087.12 and AK123217.1. On Sep 25, 2007 this sequence version replaced gi:47271465.

RefSeq NP_659464.3
CDS 96..2540
Exon (1)1..161
Exon (2)1..161
Exon (3)162..271
Exon (4)272..346
Exon (5)347..494
Exon (6)495..604
Exon (7)605..734
Exon (8)735..941
Exon (9)942..1085
Exon (10)1086..1172
Exon (11)1173..1276
Exon (12)1277..1382
Exon (13)1383..1521
Exon (14)1522..1740
Exon (15)1741..1849
Exon (16)1850..1905
Exon (17)1906..1956
Exon (18)1957..2041
Exon (19)2042..2177
Exon (20)2178..2275
Exon (21)2276..2326
Exon (22)2327..2416
Exon (23)2417..2523
Exon (24)2524..3972
Translation MVKQTIQIFARVKPPVRKHQQGIYSIDEDEKLIPSLEIILPRDLADGFVNNKRESYKFKF QRIFDQDANQETVFENIAKPVAGSVLAGYNGTIFAYGQTGSGKTFTITGGAERYSDRGII PRTLSYIFEQLQKDSSKIYTTHISYLEIYNECGYDLLDPRHEASSLEDLPKVTILEDPDQ NIHLKNLTLHQATTEEEALNLLFLGDTNRMIAETPMNQASTRSHCIFTIHLSSKEPGSAT VRHAKLHLVDLAGSERVAKTGVGGHLLTEAKYINLSLHYLEQVIIALSEKHRSHIPYRNS MMTSVLRDSLGGNCMTTMIATLSLEKRNLDESISTCRFAQRVALIKNEAVLNEEINPRLV IKRLQKEIQELKDELAMVTGEQRTEALTEAELLQLEKLITSFLEDQDSDSRLEVGADMRK VHHCFHHLKKLLNDKKILENNTVSSESKDQDCQEPLKEEEYRKLRDILKQRDNEINILVN MLKKEKKKAQEALHLAGMDRREFRQSQSPPFRLGNPEEGQRMRLSSAPSQAQDFSILGKR SSLLHKKIGMREEMSLGCQEAFEIFKRDHADSVTIDDNKQILKQRFSEAKALGESINEAR SKIGHLKEEITQRHIQQVALGISENMAVPLMPDQQEEKLRSQLEEEKRRYKTMFTRLKAL KVEIEHLQLLMDKAKVKLQKEFEVWWAEEATNLQVNSPAVNSLDHTKPFLQTSDSQHEWS QLLSNKSSGGWEVQDQGTGRFDVCDVNARKILPSPCPSPHSQKQSSTSTPLEDSIPKRPV SSIPLTGDSQTDSDIIAFIKARQSILQKQCLGSN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(198)-t, cdbSNP:114269617
complement(215)-t, cdbSNP:34016507
complement(282)-t, cdbSNP:34059104
complement(807)-g, adbSNP:113952912
complement(908)-t, cdbSNP:7738892
complement(996)-t, cdbSNP:36103565
complement(1422)-t, cdbSNP:35723069
1630+a, gdbSNP:2273063
complement(1659)-t, adbSNP:114951361
complement(1747)-t, cdbSNP:61748649
complement(1829)-g, adbSNP:61757646
complement(1892)-t, cdbSNP:111841262
complement(1953)-g, adbSNP:35249324
2250+c, tdbSNP:20455
complement(2438)-t, cdbSNP:34836492
complement(2636)-t, cdbSNP:16891957
complement(2637)-c, adbSNP:3734621
complement(2745)-t, cdbSNP:72858477
complement(2836)-t, adbSNP:74659777
complement(2882)-g, adbSNP:11756686
complement(2970)-g, adbSNP:116706958
complement(2978)-t, cdbSNP:3823213
complement(3008)-t, cdbSNP:11758639
complement(3035)-g, adbSNP:73731795
complement(3041)-t, cdbSNP:10947807
complement(3093)-g, adbSNP:6904582
complement(3205)-t, cdbSNP:117842239
complement(3254)-g, adbSNP:9462531
complement(3541)-t, cdbSNP:115025619
complement(3566)-g, adbSNP:16891944
complement(3682)-t, adbSNP:72858469
complement(3910)-t, cdbSNP:114582772
complement(3972)-t, cdbSNP:72858468
Gene SymbolKIF6
Gene SynonymC6orf102; dJ1043E3.1; dJ137F1.4; dJ188D3.1; DKFZp451I2418; MGC33317
Chromosome6
Locus Map6p21.2
All Transcripts NM_145027
Title Genetic variants in the KIF6 region and coronary event reduction from statin therapy .
Author Li,Y., Sabatine,M.S., Tong,C.H., Ford,I., Kirchgessner,T.G., Packard,C.J., Robertson,M., Rowland,C.M., Bare,L.A., Shepherd,J., Devlin,J.J. and Iakoubova,O.A.
Journal Hum. Genet. 129 (1), 17-23 (2011)
Title Lack of association between the Trp719Arg polymorphism in kinesin-like protein-6 and coronary artery disease in 19 case-control studies .
Author Assimes,T.L., Holm,H., Kathiresan,S., Reilly,M.P., Thorleifsson,G., Voight,B.F., Erdmann,J., Willenborg,C., Vaidya,D., Xie,C., Patterson,C.C., Morgan,T.M., Burnett,M.S., Li,M., Hlatky,M.A., Knowles,J.W., Thompson,J.R., Absher,D., Iribarren,C., Go,A., Fortmann,S.P., Sidney,S., Risch,N., Tang,H., Myers,R.M., Berger,K., Stoll,M., Shah,S.H., Thorgeirsson,G., Andersen,K., Havulinna,A.S., Herrera,J.E., Faraday,N., Kim,Y., Kral,B.G., Mathias,R.A., Ruczinski,I., Suktitipat,B., Wilson,A.F., Yanek,L.R., Becker,L.C., Linsel-Nitschke,P., Lieb,W., Konig,I.R., Hengstenberg,C., Fischer,M., Stark,K., Reinhard,W., Winogradow,J., Grassl,M., Grosshennig,A., Preuss,M., Schreiber,S., Wichmann,H.E., Meisinger,C., Yee,J., Friedlander,Y., Do,R., Meigs,J.B., Williams,G., Nathan,D.M., MacRae,C.A., Qu,L., Wilensky,R.L., Matthai,W.H. Jr., Qasim,A.N., Hakonarson,H., Pichard,A.D., Kent,K.M., Satler,L., Lindsay,J.M., Waksman,R., Knouff,C.W., Waterworth,D.M., Walker,M.C., Mooser,V.E., Marrugat,J., Lucas,G., Subirana,I., Sala,J., Ramos,R., Martinelli,N., Olivieri,O., Trabetti,E., Malerba,G., Pignatti,P.F., Guiducci,C., Mirel,D., Parkin,M., Hirschhorn,J.N., Asselta,R., Duga,S., Musunuru,K., Daly,M.J., Purcell,S., Eifert,S., Braund,P.S., Wright,B.J., Balmforth,A.J., Ball,S.G., Ouwehand,W.H., Deloukas,P., Scholz,M., Cambien,F., Huge,A., Scheffold,T., Salomaa,V., Girelli,D., Granger,C.B., Peltonen,L., McKeown,P.P., Altshuler,D., Melander,O., Devaney,J.M., Epstein,S.E., Rader,D.J., Elosua,R., Engert,J.C., Anand,S.S., Hall,A.S., Ziegler,A., O'Donnell,C.J., Spertus,J.A., Siscovick,D., Schwartz,S.M., Becker,D., Thorsteinsdottir,U., Stefansson,K., Schunkert,H., Samani,N.J. and Quertermous,T.
Journal J. Am. Coll. Cardiol. 56 (19), 1552-1563 (2010)
Title KIF6 polymorphism as a predictor of risk of coronary events and of clinical event reduction by statin therapy .
Author Li,Y., Iakoubova,O.A., Shiffman,D., Devlin,J.J., Forrester,J.S. and Superko,H.R.
Journal Am. J. Cardiol. 106 (7), 994-998 (2010)
Title Pharmacogenetic analysis of lipid responses to rosuvastatin in Chinese patients .
Author Hu,M., Lui,S.S., Mak,V.W., Chu,T.T., Lee,V.W., Poon,E.W., Tsui,T.K., Ko,G.T., Baum,L., Tam,L.S., Li,E.K. and Tomlinson,B.
Journal Pharmacogenet. Genomics 20 (10), 634-637 (2010)
Title Investigation of KIF6 Trp719Arg in a case-control study of myocardial infarction: a Costa Rican population .
Author Bare,L.A., Ruiz-Narvaez,E.A., Tong,C.H., Arellano,A.R., Rowland,C.M., Catanese,J.J., Sacks,F.M., Devlin,J.J. and Campos,H.
Journal PLoS ONE 5 (9) (2010)
Title A kinesin family member 6 variant is associated with coronary heart disease in the Women's Health Study .
Author Shiffman,D., Chasman,D.I., Zee,R.Y., Iakoubova,O.A., Louie,J.Z., Devlin,J.J. and Ridker,P.M.
Journal J. Am. Coll. Cardiol. 51 (4), 444-448 (2008)
Title Association of the Trp719Arg polymorphism in kinesin-like protein 6 with myocardial infarction and coronary heart disease in 2 prospective trials: the CARE and WOSCOPS trials .
Author Iakoubova,O.A., Tong,C.H., Rowland,C.M., Kirchgessner,T.G., Young,B.A., Arellano,A.R., Shiffman,D., Sabatine,M.S., Campos,H., Packard,C.J., Pfeffer,M.A., White,T.J., Braunwald,E., Shepherd,J., Devlin,J.J. and Sacks,F.M.
Journal J. Am. Coll. Cardiol. 51 (4), 435-443 (2008)
Title Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study .
Author Shiffman,D., O'Meara,E.S., Bare,L.A., Rowland,C.M., Louie,J.Z., Arellano,A.R., Lumley,T., Rice,K., Iakoubova,O., Luke,M.M., Young,B.A., Malloy,M.J., Kane,J.P., Ellis,S.G., Tracy,R.P., Devlin,J.J. and Psaty,B.M.
Journal Arterioscler. Thromb. Vasc. Biol. 28 (1), 173-179 (2008)
Title Five common gene variants identify elevated genetic risk for coronary heart disease .
Author Bare,L.A., Morrison,A.C., Rowland,C.M., Shiffman,D., Luke,M.M., Iakoubova,O.A., Kane,J.P., Malloy,M.J., Ellis,S.G., Pankow,J.S., Willerson,J.T., Devlin,J.J. and Boerwinkle,E.
Journal Genet. Med. 9 (10), 682-689 (2007)
Title The DNA sequence and analysis of human chromosome 6 .
Author Mungall,A.J., Palmer,S.A., Sims,S.K., Edwards,C.A., Ashurst,J.L., Wilming,L., Jones,M.C., Horton,R., Hunt,S.E., Scott,C.E., Gilbert,J.G., Clamp,M.E., Bethel,G., Milne,S., Ainscough,R., Almeida,J.P., Ambrose,K.D., Andrews,T.D., Ashwell,R.I., Babbage,A.K., Bagguley,C.L., Bailey,J., Banerjee,R., Barker,D.J., Barlow,K.F., Bates,K., Beare,D.M., Beasley,H., Beasley,O., Bird,C.P., Blakey,S., Bray-Allen,S., Brook,J., Brown,A.J., Brown,J.Y., Burford,D.C., Burrill,W., Burton,J., Carder,C., Carter,N.P., Chapman,J.C., Clark,S.Y., Clark,G., Clee,C.M., Clegg,S., Cobley,V., Collier,R.E., Collins,J.E., Colman,L.K., Corby,N.R., Coville,G.J., Culley,K.M., Dhami,P., Davies,J., Dunn,M., Earthrowl,M.E., Ellington,A.E., Evans,K.A., Faulkner,L., Francis,M.D., Frankish,A., Frankland,J., French,L., Garner,P., Garnett,J., Ghori,M.J., Gilby,L.M., Gillson,C.J., Glithero,R.J., Grafham,D.V., Grant,M., Gribble,S., Griffiths,C., Griffiths,M., Hall,R., Halls,K.S., Hammond,S., Harley,J.L., Hart,E.A., Heath,P.D., Heathcott,R., Holmes,S.J., Howden,P.J., Howe,K.L., Howell,G.R., Huckle,E., Humphray,S.J., Humphries,M.D., Hunt,A.R., Johnson,C.M., Joy,A.A., Kay,M., Keenan,S.J., Kimberley,A.M., King,A., Laird,G.K., Langford,C., Lawlor,S., Leongamornlert,D.A., Leversha,M., Lloyd,C.R., Lloyd,D.M., Loveland,J.E., Lovell,J., Martin,S., Mashreghi-Mohammadi,M., Maslen,G.L., Matthews,L., McCann,O.T., McLaren,S.J., McLay,K., McMurray,A., Moore,M.J., Mullikin,J.C., Niblett,D., Nickerson,T., Novik,K.L., Oliver,K., Overton-Larty,E.K., Parker,A., Patel,R., Pearce,A.V., Peck,A.I., Phillimore,B., Phillips,S., Plumb,R.W., Porter,K.M., Ramsey,Y., Ranby,S.A., Rice,C.M., Ross,M.T., Searle,S.M., Sehra,H.K., Sheridan,E., Skuce,C.D., Smith,S., Smith,M., Spraggon,L., Squares,S.L., Steward,C.A., Sycamore,N., Tamlyn-Hall,G., Tester,J., Theaker,A.J., Thomas,D.W., Thorpe,A., Tracey,A., Tromans,A., Tubby,B., Wall,M., Wallis,J.M., West,A.P., White,S.S., Whitehead,S.L., Whittaker,H., Wild,A., Willey,D.J., Wilmer,T.E., Wood,J.M., Wray,P.W., Wyatt,J.C., Young,L., Younger,R.M., Bentley,D.R., Coulson,A., Durbin,R., Hubbard,T., Sulston,J.E., Dunham,I., Rogers,J. and Beck,S.
Journal Nature 425 (6960), 805-811 (2003)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878