• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens calreticulin 3 (CALR3), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_145046 Homo sapiens calreticulin 3 (CALR3), mRNA. GenEZ ORF Cloning On-demand $549.00 14

*Business Day

Related Services

RefSeq Version NM_145046.4, 364023779
Length 1295 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens calreticulin 3 (CALR3), mRNA.
Product calreticulin-3 precursor
Comment

Summary: The protein encoded by this gene belongs to the calreticulin family, members of which are calcium-binding chaperones localized mainly in the endoplasmic reticulum. This protein is also localized to the endoplasmic reticulum lumen, however, its capacity for calcium-binding may be absent or much lower than other family members. This gene is specifically expressed in the testis, and may be required for sperm fertility. Mutation in this gene has been associated with familial hypertrophic cardiomyopathy. [provided by RefSeq, Dec 2011].


##Evidence-Data-START## Transcript exon combination :: BC014595.2, AK058084.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025084, ERS025087 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_659483.2
CDS 64..1218
Misc Feature(1)25..27
Misc Feature(2)25..27
Misc Feature(3)121..654
Misc Feature(4)124..1017
Misc Feature(5)634..798
Misc Feature(6)655..945
Misc Feature(7)808..912
Misc Feature(8)946..1215
Misc Feature(9)1204..1215
Exon (1)1..154
Gene:CALR3
Gene Synonym:CMH19; CRT2; CT93
Exon (2)155..256
Gene:CALR3
Gene Synonym:CMH19; CRT2; CT93
Exon (3)257..460
Gene:CALR3
Gene Synonym:CMH19; CRT2; CT93
Exon (4)461..555
Gene:CALR3
Gene Synonym:CMH19; CRT2; CT93
Exon (5)556..741
Gene:CALR3
Gene Synonym:CMH19; CRT2; CT93
Exon (6)742..849
Gene:CALR3
Gene Synonym:CMH19; CRT2; CT93
Exon (7)850..981
Gene:CALR3
Gene Synonym:CMH19; CRT2; CT93
Exon (8)982..1074
Gene:CALR3
Gene Synonym:CMH19; CRT2; CT93
Exon (9)1075..1292
Gene:CALR3
Gene Synonym:CMH19; CRT2; CT93
Translation MARALVQLWAICMLRVALATVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHK EKDKGLQTTQNGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQK NLNGKSQYYIMFGPDICGFDIKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDL SYDVKIDGQSIESGSIEYDWNLTSLKKETSPAESKDWEQTKDNKAQDWEKHFLDASTSKQ SDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKMKNTDYLTQYDLSEFENIGAI GLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEE EELLSGKINRHEHYFNQFHRRNEL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(30)-g, cdbSNP:199995239
complement(53)-c, adbSNP:371362207
complement(84)-g, cdbSNP:201886703
85+c, tdbSNP:11544148
complement(91)-t, cdbSNP:3810201
complement(123)-g, cdbSNP:370721650
complement(130)-t, adbSNP:368506422
complement(159)-dbSNP:
complement(159)-g, adbSNP:144355944
complement(188)-t, cdbSNP:149634686
complement(222)-t, cdbSNP:372912264
complement(224)-t, cdbSNP:147300344
complement(229)-g, adbSNP:201808529
complement(232)-g, adbSNP:368523051
complement(233)-t, cdbSNP:138350128
complement(252)-c, adbSNP:201304731
complement(263)-dbSNP:
complement(263)-t, cdbSNP:150907410
complement(275)-t, cdbSNP:369859530
complement(278)-t, cdbSNP:182376945
complement(280)-g, cdbSNP:199561391
complement(281)-t, cdbSNP:372657559
complement(306)-g, adbSNP:201321577
complement(308)-t, cdbSNP:142951029
complement(331)-t, gdbSNP:200449193
complement(386)-g, cdbSNP:139061471
complement(399)-g, cdbSNP:185241971
complement(441)-t, cdbSNP:374869347
complement(444)-t, cdbSNP:3810198
complement(466)-dbSNP:
complement(466)-t, cdbSNP:143932873
complement(513)-g, adbSNP:148241645
complement(546)-t, gdbSNP:143158265
complement(571)-dbSNP:
complement(571)-t, gdbSNP:376733366
complement(580)-t, cdbSNP:374187284
complement(583)-t, gdbSNP:143671909
complement(609)-g, adbSNP:369476772
complement(642)-g, adbSNP:149108772
complement(657)-g, adbSNP:145046810
complement(671)-g, adbSNP:150376706
complement(682)-t, cdbSNP:111870908
complement(702)-t, cdbSNP:377026384
complement(705)-t, cdbSNP:200669493
complement(711)-g, adbSNP:372889302
complement(730)-t, cdbSNP:368652672
complement(765)-dbSNP:
complement(765)-g, adbSNP:10403020
complement(787)-t, cdbSNP:146669521
complement(795)-g, adbSNP:201198066
complement(806)-t, cdbSNP:10411092
complement(808)-t, cdbSNP:267605330
complement(813)-g, adbSNP:149008417
complement(840)-g, adbSNP:143252466
complement(847)-g, adbSNP:267605329
complement(850)-dbSNP:
complement(850)-g, cdbSNP:200056222
complement(882)-g, adbSNP:371638034
complement(883)-t, cdbSNP:12459238
complement(888)-c, adbSNP:183119380
complement(911)-g, adbSNP:75099211
complement(912)-g, adbSNP:142902333
complement(913)-t, cdbSNP:10404156
complement(924)-t, cdbSNP:118131979
complement(926)-t, cdbSNP:201922129
complement(964)-g, cdbSNP:374467745
complement(986)-dbSNP:
complement(986)-c, adbSNP:369518093
complement(1024)-t, cdbSNP:143334090
complement(1035)-g, adbSNP:9305079
complement(1039)-g, cdbSNP:147253682
complement(1065)-g, adbSNP:143913852
complement(1066)-t, cdbSNP:199535524
complement(1092)-dbSNP:
complement(1092)-t, cdbSNP:371168255
complement(1122)-g, cdbSNP:138239732
complement(1129)-g, adbSNP:150430942
complement(1130)-c, adbSNP:140290452
complement(1131)-g, adbSNP:148039385
complement(1141)-c, adbSNP:200524093
complement(1150)-g, adbSNP:199900092
complement(1152)-c, adbSNP:201203591
complement(1158)-t, cdbSNP:200844516
complement(1177)-g, cdbSNP:140440387
complement(1178)-t, cdbSNP:375160369
complement(1192)-g, cdbSNP:372514243
complement(1210)-t, cdbSNP:368434498
complement(1239)-c, adbSNP:145534922
Gene SymbolCALR3
Gene SynonymCMH19; CRT2; CT93
Chromosome19
Locus Map19p13.11
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_145046 Homo sapiens calreticulin 3 (CALR3), mRNA. On-demand $549.00 14
Title Multiple loci are associated with white blood cell phenotypes .
Author Nalls MA, Couper DJ, Tanaka T, van Rooij FJ, Chen MH, Smith AV, Toniolo D, Zakai NA, Yang Q, Greinacher A, Wood AR, Garcia M, Gasparini P, Liu Y, Lumley T, Folsom AR, Reiner AP, Gieger C, Lagou V, Felix JF, Volzke H, Gouskova NA, Biffi A, Doring A, Volker U, Chong S, Wiggins KL, Rendon A, Dehghan A, Moore M, Taylor K, Wilson JG, Lettre G, Hofman A, Bis JC, Pirastu N, Fox CS, Meisinger C, Sambrook J, Arepalli S, Nauck M, Prokisch H, Stephens J, Glazer NL, Cupples LA, Okada Y, Takahashi A, Kamatani Y, Matsuda K, Tsunoda T, Tanaka T, Kubo M, Nakamura Y, Yamamoto K, Kamatani N, Stumvoll M, Tonjes A, Prokopenko I, Illig T, Patel KV, Garner SF, Kuhnel B, Mangino M, Oostra BA, Thein SL, Coresh J, Wichmann HE, Menzel S, Lin J, Pistis G, Uitterlinden AG, Spector TD, Teumer A, Eiriksdottir G, Gudnason V, Bandinelli S, Frayling TM, Chakravarti A, van Duijn CM, Melzer D, Ouwehand WH, Levy D, Boerwinkle E, Singleton AB, Hernandez DG, Longo DL, Soranzo N, Witteman JC, Psaty BM, Ferrucci L, Harris TB, O'Donnell CJ and Ganesh SK.
Journal PLoS Genet. 7 (6), E1002113 (2011)
Title Calreticulin-2 is localized in the lumen of the endoplasmic reticulum but is not a Ca2+ -binding protein .
Author Nomura R, Orii M and Senda T.
Journal Histochem. Cell Biol. 135 (6), 531-538 (2011)
Title Identification of a novel cancer-testis antigen CRT2 frequently expressed in various cancers using representational differential analysis .
Author Hayashi E, Matsuzaki Y, Hasegawa G, Yaguchi T, Kurihara S, Fujita T, Kageshita T, Sano M and Kawakami Y.
Journal Clin. Cancer Res. 13 (21), 6267-6274 (2007)
Title Identification of a novel calreticulin isoform (Crt2) in human and mouse .
Author Persson S, Rosenquist M and Sommarin M.
Journal Gene 297 (1-2), 151-158 (2002)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.