• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens NK2 homeobox 3 (NKX2-3), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_145285 Homo sapiens NK2 homeobox 3 (NKX2-3), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_145285.2, 148746210
Length 2117 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens NK2 homeobox 3 (NKX2-3), mRNA.
Product homeobox protein Nkx-2.3
Comment

Summary: This gene encodes a homeodomain-containing transcription factor. The encoded protein is a member of the NKX family of homeodomain transcription factors. Studies of similar proteins in mouse and rat have indicated a potential role in cellular differentiation.[provided by RefSeq, Mar 2010].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by orthologous data and transcript alignments.

RefSeq NP_660328.2
CDS 200..1294
Misc Feature(1)188..190
Misc Feature(2)644..820
Misc Feature(3)644..820
Misc Feature(4)order(644..658,662..664,713..715,731..733,770..772,
Misc Feature(5)order(650..652,659..661,779..781,788..793,800..802)
Exon (1)1..557
Gene:NKX2-3
Gene Synonym:CSX3; NK2.3; NKX2.3; NKX2C; NKX4-3
Exon (2)558..2097
Gene:NKX2-3
Gene Synonym:CSX3; NK2.3; NKX2.3; NKX2C; NKX4-3
Translation MMLPSPVTSTPFSVKDILNLEQQHQHFHGAHLQADLEHHFHSAPCMLAAAEGTQFSDGGE EDEEDEGEKLSYLNSLAAADGHGDSGLCPQGYVHTVLRDSCSEPKEHEEEPEVVRDRSQK SCQLKKSLETAGDCKAAEESERPKPRSRRKPRVLFSQAQVFELERRFKQQRYLSAPEREH LASSLKLTSTQVKIWFQNRRYKCKRQRQDKSLELGAHAPPPPPRRVAVPVLVRDGKPCVT PSAQAYGAPYSVGASAYSYNSFPAYGYGNSAAAAAAAAAAAAAAAAYSSSYGCAYPAGGG GGGGGTSAATTAMQPACSAAGGGPFVNVSNLGGFGSGGSAQPLHQGTAAGAACAQGTLQG IRAW
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
2+dbSNP:
2+g, tdbSNP:59938878
94+c, gdbSNP:186852925
95+a, gdbSNP:191738640
117+c, tdbSNP:375600503
164+a, gdbSNP:182105542
225+c, gdbSNP:368583740
268+a, gdbSNP:369827413
270+a, gdbSNP:372618389
275+c, tdbSNP:376888249
289+a, gdbSNP:368978920
complement(315)-c, adbSNP:77050787
325+c, tdbSNP:373486169
336+c, tdbSNP:199963044
343+c, tdbSNP:372117331
344+a, gdbSNP:201429667
346+a, cdbSNP:41290504
371+a, gdbSNP:374176845
408+g, tdbSNP:114975224
439+c, tdbSNP:145887258
446+a, gdbSNP:200446284
452+g, tdbSNP:370885897
533+a, gdbSNP:373715351
589+dbSNP:
589+g, tdbSNP:367821133
632+a, cdbSNP:79873574
655+c, gdbSNP:374871429
667+a, gdbSNP:184601313
752+c, tdbSNP:113459553
781+a, cdbSNP:78122843
813+a, gdbSNP:369954020
852+c, tdbSNP:372919519
959+c, gdbSNP:200509540
1012+c, gdbSNP:59754112
1018+c, gdbSNP:60505509
1021+c, gdbSNP:59941155
1042+a, cdbSNP:10082511
1272+g, tdbSNP:151053941
1469..1470+, adbSNP:5787350
1470..1471+, adbSNP:397844973
1471+c, tdbSNP:199863832
1531+c, tdbSNP:368108882
1585+c, tdbSNP:141309484
complement(1679)-t, cdbSNP:888208
1748+c, tdbSNP:7906496
1783+c, tdbSNP:374205970
1790+a, gdbSNP:145068124
1815+g, tdbSNP:138803080
1837+a, gdbSNP:141988959
1845+g, tdbSNP:188570312
1908+g, tdbSNP:7906748
1913+a, gdbSNP:78952335
1956+c, tdbSNP:181369263
2000..2001+, tatcdbSNP:376401553
Gene SymbolNKX2-3
Gene SynonymCSX3; NK2.3; NKX2.3; NKX2C; NKX4-3
Chromosome10
Locus Map10q24.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_145285 Homo sapiens NK2 homeobox 3 (NKX2-3), mRNA. On-demand TBD TBD
Title GWAS of dental caries patterns in the permanent dentition .
Author Shaffer JR, Feingold E, Wang X, Lee M, Tcuenco K, Weeks DE, Weyant RJ, Crout R, McNeil DW and Marazita ML.
Journal J. Dent. Res. 92 (1), 38-44 (2013)
Title Seventy-five genetic loci influencing the human red blood cell .
Author van der Harst P, Zhang W, Mateo Leach I, Rendon A, Verweij N, Sehmi J, Paul DS, Elling U, Allayee H, Li X, Radhakrishnan A, Tan ST, Voss K, Weichenberger CX, Albers CA, Al-Hussani A, Asselbergs FW, Ciullo M, Danjou F, Dina C, Esko T, Evans DM, Franke L, Gogele M, Hartiala J, Hersch M, Holm H, Hottenga JJ, Kanoni S, Kleber ME, Lagou V, Langenberg C, Lopez LM, Lyytikainen LP, Melander O, Murgia F, Nolte IM, O'Reilly PF, Padmanabhan S, Parsa A, Pirastu N, Porcu E, Portas L, Prokopenko I, Ried JS, Shin SY, Tang CS, Teumer A, Traglia M, Ulivi S, Westra HJ, Yang J, Zhao JH, Anni F, Abdellaoui A, Attwood A, Balkau B, Bandinelli S, Bastardot F, Benyamin B, Boehm BO, Cookson WO, Das D, de Bakker PI, de Boer RA, de Geus EJ, de Moor MH, Dimitriou M, Domingues FS, Doring A, Engstrom G, Eyjolfsson GI, Ferrucci L, Fischer K, Galanello R, Garner SF, Genser B, Gibson QD, Girotto G, Gudbjartsson DF, Harris SE, Hartikainen AL, Hastie CE, Hedblad B, Illig T, Jolley J, Kahonen M, Kema IP, Kemp JP, Liang L, Lloyd-Jones H, Loos RJ, Meacham S, Medland SE, Meisinger C, Memari Y, Mihailov E, Miller K, Moffatt MF, Nauck M, Novatchkova M, Nutile T, Olafsson I, Onundarson PT, Parracciani D, Penninx BW, Perseu L, Piga A, Pistis G, Pouta A, Puc U, Raitakari O, Ring SM, Robino A, Ruggiero D, Ruokonen A, Saint-Pierre A, Sala C, Salumets A, Sambrook J, Schepers H, Schmidt CO, Sillje HH, Sladek R, Smit JH, Starr JM, Stephens J, Sulem P, Tanaka T, Thorsteinsdottir U, Tragante V, van Gilst WH, van Pelt LJ, van Veldhuisen DJ, Volker U, Whitfield JB, Willemsen G, Winkelmann BR, Wirnsberger G, Algra A, Cucca F, d'Adamo AP, Danesh J, Deary IJ, Dominiczak AF, Elliott P, Fortina P, Froguel P, Gasparini P, Greinacher A, Hazen SL, Jarvelin MR, Khaw KT, Lehtimaki T, Maerz W, Martin NG, Metspalu A, Mitchell BD, Montgomery GW, Moore C, Navis G, Pirastu M, Pramstaller PP, Ramirez-Solis R, Schadt E, Scott J, Shuldiner AR, Smith GD, Smith JG, Snieder H, Sorice R, Spector TD, Stefansson K, Stumvoll M, Tang WH, Toniolo D, Tonjes A, Visscher PM, Vollenweider P, Wareham NJ, Wolffenbuttel BH, Boomsma DI, Beckmann JS, Dedoussis GV, Deloukas P, Ferreira MA, Sanna S, Uda M, Hicks AA, Penninger JM, Gieger C, Kooner JS, Ouwehand WH, Soranzo N and Chambers JC.
Journal Nature 492 (7429), 369-375 (2012)
Title Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease .
Author Jostins L, Ripke S, Weersma RK, Duerr RH, McGovern DP, Hui KY, Lee JC, Schumm LP, Sharma Y, Anderson CA, Essers J, Mitrovic M, Ning K, Cleynen I, Theatre E, Spain SL, Raychaudhuri S, Goyette P, Wei Z, Abraham C, Achkar JP, Ahmad T, Amininejad L, Ananthakrishnan AN, Andersen V, Andrews JM, Baidoo L, Balschun T, Bampton PA, Bitton A, Boucher G, Brand S, Buning C, Cohain A, Cichon S, D'Amato M, De Jong D, Devaney KL, Dubinsky M, Edwards C, Ellinghaus D, Ferguson LR, Franchimont D, Fransen K, Gearry R, Georges M, Gieger C, Glas J, Haritunians T, Hart A, Hawkey C, Hedl M, Hu X, Karlsen TH, Kupcinskas L, Kugathasan S, Latiano A, Laukens D, Lawrance IC, Lees CW, Louis E, Mahy G, Mansfield J, Morgan AR, Mowat C, Newman W, Palmieri O, Ponsioen CY, Potocnik U, Prescott NJ, Regueiro M, Rotter JI, Russell RK, Sanderson JD, Sans M, Satsangi J, Schreiber S, Simms LA, Sventoraityte J, Targan SR, Taylor KD, Tremelling M, Verspaget HW, De Vos M, Wijmenga C, Wilson DC, Winkelmann J, Xavier RJ, Zeissig S, Zhang B, Zhang CK, Zhao H, Silverberg MS, Annese V, Hakonarson H, Brant SR, Radford-Smith G, Mathew CG, Rioux JD, Schadt EE, Daly MJ, Franke A, Parkes M, Vermeire S, Barrett JC and Cho JH.
Journal Nature 491 (7422), 119-124 (2012)
Title A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci .
Author Kenny EE, Pe'er I, Karban A, Ozelius L, Mitchell AA, Ng SM, Erazo M, Ostrer H, Abraham C, Abreu MT, Atzmon G, Barzilai N, Brant SR, Bressman S, Burns ER, Chowers Y, Clark LN, Darvasi A, Doheny D, Duerr RH, Eliakim R, Giladi N, Gregersen PK, Hakonarson H, Jones MR, Marder K, McGovern DP, Mulle J, Orr-Urtreger A, Proctor DD, Pulver A, Rotter JI, Silverberg MS, Ullman T, Warren ST, Waterman M, Zhang W, Bergman A, Mayer L, Katz S, Desnick RJ, Cho JH and Peter I.
Journal PLoS Genet. 8 (3), E1002559 (2012)
Title PTPN2 is associated with Crohn's disease and its expression is regulated by NKX2-3 .
Author Yu W, Hegarty JP, Berg A, Kelly AA, Wang Y, Poritz LS, Franke A, Schreiber S, Koltun WA and Lin Z.
Journal Dis. Markers 32 (2), 83-91 (2012)
Title Sequence variants in the autophagy gene IRGM and multiple other replicating loci contribute to Crohn's disease susceptibility .
Author Parkes M, Barrett JC, Prescott NJ, Tremelling M, Anderson CA, Fisher SA, Roberts RG, Nimmo ER, Cummings FR, Soars D, Drummond H, Lees CW, Khawaja SA, Bagnall R, Burke DA, Todhunter CE, Ahmad T, Onnie CM, McArdle W, Strachan D, Bethel G, Bryan C, Lewis CM, Deloukas P, Forbes A, Sanderson J, Jewell DP, Satsangi J, Mansfield JC, Cardon L and Mathew CG.
Journal Nat. Genet. 39 (7), 830-832 (2007)
Title Genome-wide association study of 14,000 cases of seven common diseases and 3,000 shared controls .
Author
Journal Nature 447 (7145), 661-678 (2007)
Title NK-2 class homeobox genes and pharyngeal/oral patterning: Nkx2-3 is required for salivary gland and tooth morphogenesis .
Author Biben C, Wang CC and Harvey RP.
Journal Int. J. Dev. Biol. 46 (4), 415-422 (2002)
Title Differential binding of an SRF/NK-2/MEF2 transcription factor complex in normal versus neoplastic smooth muscle tissues .
Author Phiel CJ, Gabbeta V, Parsons LM, Rothblat D, Harvey RP and McHugh KM.
Journal J. Biol. Chem. 276 (37), 34637-34650 (2001)
Title NK-2 homeobox genes and heart development .
Author Harvey RP.
Journal Dev. Biol. 178 (2), 203-216 (1996)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.