• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens NK2 homeobox 3 (NKX2-3), mRNA.


RefSeq Accession Definition Services Price Order
NM_145285 Homo sapiens NK2 homeobox 3 (NKX2-3), mRNA. ORF Sequence $317.55
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_145285.2, 148746210
Length 2117 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens NK2 homeobox 3 (NKX2-3), mRNA.
Product homeobox protein Nkx-2.3
Comment

Summary: This gene encodes a homeodomain-containing transcription factor. The encoded protein is a member of the NKX family of homeodomain transcription factors. Studies of similar proteins in mouse and rat have indicated a potential role in cellular differentiation.[provided by RefSeq, Mar 2010].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by orthologous data and transcript alignments.

RefSeq NP_660328.2
CDS 200..1294
Misc Feature(1)188..190
Misc Feature(2)662..820
Misc Feature(3)662..820
Misc Feature(4)order(662..664,713..715,731..733,770..772,776..781,
Misc Feature(5)order(779..781,788..793,800..802)
Exon (1)1..557
Gene:NKX2-3
Gene Synonym:CSX3; NK2.3; NKX2.3; NKX2C; NKX4-3
Exon (2)558..2097
Gene:NKX2-3
Gene Synonym:CSX3; NK2.3; NKX2.3; NKX2C; NKX4-3
Translation MMLPSPVTSTPFSVKDILNLEQQHQHFHGAHLQADLEHHFHSAPCMLAAAEGTQFSDGGE EDEEDEGEKLSYLNSLAAADGHGDSGLCPQGYVHTVLRDSCSEPKEHEEEPEVVRDRSQK SCQLKKSLETAGDCKAAEESERPKPRSRRKPRVLFSQAQVFELERRFKQQRYLSAPEREH LASSLKLTSTQVKIWFQNRRYKCKRQRQDKSLELGAHAPPPPPRRVAVPVLVRDGKPCVT PSAQAYGAPYSVGASAYSYNSFPAYGYGNSAAAAAAAAAAAAAAAAYSSSYGCAYPAGGG GGGGGTSAATTAMQPACSAAGGGPFVNVSNLGGFGSGGSAQPLHQGTAAGAACAQGTLQG IRAW
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
2+dbSNP:
2+g, tdbSNP:59938878
94+c, gdbSNP:186852925
95+a, gdbSNP:191738640
164+a, gdbSNP:182105542
315+a, cdbSNP:77050787
336+c, tdbSNP:199963044
344+a, gdbSNP:201429667
346+a, cdbSNP:41290504
408+g, tdbSNP:114975224
439+c, tdbSNP:145887258
446+a, gdbSNP:200446284
632+dbSNP:
632+a, cdbSNP:79873574
667+a, gdbSNP:184601313
752+c, tdbSNP:113459553
781+a, cdbSNP:78122843
959+c, gdbSNP:200509540
1012+c, gdbSNP:59754112
1018+c, gdbSNP:60505509
1021+c, gdbSNP:59941155
1042+a, cdbSNP:10082511
1272+g, tdbSNP:151053941
1469..1470+, adbSNP:5787350
1470..1471+, adbSNP:5787351
1471+c, tdbSNP:199863832
1585+c, tdbSNP:141309484
1679+c, tdbSNP:888208
1748+c, tdbSNP:7906496
1790+a, gdbSNP:145068124
1815+g, tdbSNP:138803080
1837+a, gdbSNP:141988959
1845+g, tdbSNP:188570312
1908+g, tdbSNP:7906748
1913+a, gdbSNP:78952335
1956+c, tdbSNP:181369263
Gene SymbolNKX2-3
Gene SynonymCSX3; NK2.3; NKX2.3; NKX2C; NKX4-3
Chromosome10
Locus Map10q24.2
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_145285 Homo sapiens NK2 homeobox 3 (NKX2-3), mRNA. Full Length $613.93
ORF Sequence $317.55
Title Genes differentially regulated by NKX2-3 in B cells between ulcerative colitis and Crohn's disease patients and possible involvement of EGR1 .
Author Yu,W., Lin,Z., Hegarty,J.P., Chen,X., Kelly,A.A., Wang,Y., Poritz,L.S. and Koltun,W.A.
Journal Inflammation 35 (3), 889-899 (2012)
Title A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci .
Author Kenny,E.E., Pe'er,I., Karban,A., Ozelius,L., Mitchell,A.A., Ng,S.M., Erazo,M., Ostrer,H., Abraham,C., Abreu,M.T., Atzmon,G., Barzilai,N., Brant,S.R., Bressman,S., Burns,E.R., Chowers,Y., Clark,L.N., Darvasi,A., Doheny,D., Duerr,R.H., Eliakim,R., Giladi,N., Gregersen,P.K., Hakonarson,H., Jones,M.R., Marder,K., McGovern,D.P., Mulle,J., Orr-Urtreger,A., Proctor,D.D., Pulver,A., Rotter,J.I., Silverberg,M.S., Ullman,T., Warren,S.T., Waterman,M., Zhang,W., Bergman,A., Mayer,L., Katz,S., Desnick,R.J., Cho,J.H. and Peter,I.
Journal PLoS Genet. 8 (3), E1002559 (2012)
Title PTPN2 is associated with Crohn's disease and its expression is regulated by NKX2-3 .
Author Yu,W., Hegarty,J.P., Berg,A., Kelly,A.A., Wang,Y., Poritz,L.S., Franke,A., Schreiber,S., Koltun,W.A. and Lin,Z.
Journal Dis. Markers 32 (2), 83-91 (2012)
Title NKX2-3 variant rs11190140 is associated with IBD and alters binding of NFAT .
Author John,G., Hegarty,J.P., Yu,W., Berg,A., Pastor,D.M., Kelly,A.A., Wang,Y., Poritz,L.S., Schreiber,S., Koltun,W.A. and Lin,Z.
Journal Mol. Genet. Metab. 104 (1-2), 174-179 (2011)
Title NKX2-3 transcriptional regulation of endothelin-1 and VEGF signaling in human intestinal microvascular endothelial cells .
Author Yu,W., Hegarty,J.P., Berg,A., Chen,X., West,G., Kelly,A.A., Wang,Y., Poritz,L.S., Koltun,W.A. and Lin,Z.
Journal PLoS ONE 6 (5), E20454 (2011)
Title Sequence variants in the autophagy gene IRGM and multiple other replicating loci contribute to Crohn's disease susceptibility .
Author Parkes,M., Barrett,J.C., Prescott,N.J., Tremelling,M., Anderson,C.A., Fisher,S.A., Roberts,R.G., Nimmo,E.R., Cummings,F.R., Soars,D., Drummond,H., Lees,C.W., Khawaja,S.A., Bagnall,R., Burke,D.A., Todhunter,C.E., Ahmad,T., Onnie,C.M., McArdle,W., Strachan,D., Bethel,G., Bryan,C., Lewis,C.M., Deloukas,P., Forbes,A., Sanderson,J., Jewell,D.P., Satsangi,J., Mansfield,J.C., Cardon,L. and Mathew,C.G.
Journal Nat. Genet. 39 (7), 830-832 (2007)
Title Genome-wide association study of 14,000 cases of seven common diseases and 3,000 shared controls .
Author
Journal Nature 447 (7145), 661-678 (2007)
Title NK-2 class homeobox genes and pharyngeal/oral patterning: Nkx2-3 is required for salivary gland and tooth morphogenesis .
Author Biben,C., Wang,C.C. and Harvey,R.P.
Journal Int. J. Dev. Biol. 46 (4), 415-422 (2002)
Title Differential binding of an SRF/NK-2/MEF2 transcription factor complex in normal versus neoplastic smooth muscle tissues .
Author Phiel,C.J., Gabbeta,V., Parsons,L.M., Rothblat,D., Harvey,R.P. and McHugh,K.M.
Journal J. Biol. Chem. 276 (37), 34637-34650 (2001)
Title NK-2 homeobox genes and heart development .
Author Harvey,R.P.
Journal Dev. Biol. 178 (2), 203-216 (1996)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878