• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens GS homeobox 1 (GSX1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_145657 Homo sapiens GS homeobox 1 (GSX1), mRNA. GenEZ ORF Cloning In-stock $348.00 $299.00 10

*Business Day

Related Services

RefSeq Version NM_145657.1, 33457325
Length 847 bp
Structure linear
Update Date 18-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens GS homeobox 1 (GSX1), mRNA.
Product GS homeobox 1
Comment

COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AB044157.1.


##Evidence-Data-START## Transcript exon combination :: AB044157.1 [ECO:0000332] ##Evidence-Data-END##

RefSeq NP_663632.1
CDS 49..843
Misc Feature(1)49..108
Misc Feature(2)49..108
Misc Feature(3)490..666
Misc Feature(4)order(490..504,508..510,559..561,577..579,616..618,
Misc Feature(5)order(496..498,505..507,625..627,634..639,646..648)
Exon (1)1..460
Gene:GSX1
Gene Synonym:Gsh-1; GSH1
Exon (2)461..847
Gene:GSX1
Gene Synonym:Gsh-1; GSH1
Translation MPRSFLVDSLVLREAGEKKAPEGSPPPLFPYAVPPPHALHGLSPGACHARKAGLLCVCPL CVTASQLHGPPGPPALPLLKASFPPFGSQYCHAPLGRQHSAVSPGVAHGPAAAAAAAALY QTSYPLPDPRQFHCISVDSSSNQLPSSKRMRTAFTSTQLLELEREFASNMYLSRLRRIEI ATYLNLSEKQVKIWFQNRRVKHKKEGKGSNHRGGGGGGAGGGGSAPQGCKCASLSSAKCS EDDDELPMSPSSSGKDDRDLTVTP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
282+a, gdbSNP:1231058
360+c, tdbSNP:116827208
463+dbSNP:
463+a, cdbSNP:150243944
573+a, gdbSNP:146889423
588+c, tdbSNP:115980353
678+c, tdbSNP:201389990
714+a, gdbSNP:3742111
748+a, cdbSNP:200388174
807+a, gdbSNP:138515715
822+g, tdbSNP:189831013
Gene SymbolGSX1
Gene SynonymGsh-1; GSH1
Chromosome13
Locus Map13q12.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_145657 Homo sapiens GS homeobox 1 (GSX1), mRNA. In-stock $348.00 $299.00 10
Title Molecular genetic screening of MBS1 locus on chromosome 13 for microdeletions and exclusion of FGF9, GSH1 and CDX2 as causative genes in patients with Moebius syndrome .
Author Uzumcu,A., Karaman,B., Toksoy,G., Uyguner,Z.O., Candan,S., Eris,H., Tatli,B., Geckinli,B., Yuksel,A., Kayserili,H. and Basaran,S.
Journal Eur J Med Genet 52 (5), 315-320 (2009)
Title Conduct disorder and ADHD: evaluation of conduct problems as a categorical and quantitative trait in the international multicentre .
Author Anney,R.J., Lasky-Su,J., O'Dushlaine,C., Kenny,E., Neale,B.M., Mulligan,A., Franke,B., Zhou,K., Chen,W., Christiansen,H., Arias-Vasquez,A., Banaschewski,T., Buitelaar,J., Ebstein,R., Miranda,A., Mulas,F., Oades,R.D., Roeyers,H., Rothenberger,A., Sergeant,J., Sonuga-Barke,E., Steinhausen,H., Asherson,P., Faraone,S.V. and Gill,M.
Journal Am. J. Med. Genet. B Neuropsychiatr. Genet. 147B (8), 1369-1378 (2008)
Title The DNA sequence and analysis of human chromosome 13 .
Author Dunham,A., Matthews,L.H., Burton,J., Ashurst,J.L., Howe,K.L., Ashcroft,K.J., Beare,D.M., Burford,D.C., Hunt,S.E., Griffiths-Jones,S., Jones,M.C., Keenan,S.J., Oliver,K., Scott,C.E., Ainscough,R., Almeida,J.P., Ambrose,K.D., Andrews,D.T., Ashwell,R.I., Babbage,A.K., Bagguley,C.L., Bailey,J., Bannerjee,R., Barlow,K.F., Bates,K., Beasley,H., Bird,C.P., Bray-Allen,S., Brown,A.J., Brown,J.Y., Burrill,W., Carder,C., Carter,N.P., Chapman,J.C., Clamp,M.E., Clark,S.Y., Clarke,G., Clee,C.M., Clegg,S.C., Cobley,V., Collins,J.E., Corby,N., Coville,G.J., Deloukas,P., Dhami,P., Dunham,I., Dunn,M., Earthrowl,M.E., Ellington,A.G., Faulkner,L., Frankish,A.G., Frankland,J., French,L., Garner,P., Garnett,J., Gilbert,J.G., Gilson,C.J., Ghori,J., Grafham,D.V., Gribble,S.M., Griffiths,C., Hall,R.E., Hammond,S., Harley,J.L., Hart,E.A., Heath,P.D., Howden,P.J., Huckle,E.J., Hunt,P.J., Hunt,A.R., Johnson,C., Johnson,D., Kay,M., Kimberley,A.M., King,A., Laird,G.K., Langford,C.J., Lawlor,S., Leongamornlert,D.A., Lloyd,D.M., Lloyd,C., Loveland,J.E., Lovell,J., Martin,S., Mashreghi-Mohammadi,M., McLaren,S.J., McMurray,A., Milne,S., Moore,M.J., Nickerson,T., Palmer,S.A., Pearce,A.V., Peck,A.I., Pelan,S., Phillimore,B., Porter,K.M., Rice,C.M., Searle,S., Sehra,H.K., Shownkeen,R., Skuce,C.D., Smith,M., Steward,C.A., Sycamore,N., Tester,J., Thomas,D.W., Tracey,A., Tromans,A., Tubby,B., Wall,M., Wallis,J.M., West,A.P., Whitehead,S.L., Willey,D.L., Wilming,L., Wray,P.W., Wright,M.W., Young,L., Coulson,A., Durbin,R., Hubbard,T., Sulston,J.E., Beck,S., Bentley,D.R., Rogers,J. and Ross,M.T.
Journal Nature 428 (6982), 522-528 (2004)
Title Homeobox protein Gsh-1-dependent regulation of the rat GHRH gene promoter .
Author Mutsuga,N., Iwasaki,Y., Morishita,M., Nomura,A., Yamamori,E., Yoshida,M., Asai,M., Ozaki,N., Kambe,F., Seo,H., Oiso,Y. and Saito,H.
Journal Mol. Endocrinol. 15 (12), 2149-2156 (2001)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.