• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens GS homeobox 1 (GSX1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu02093 Homo sapiens GS homeobox 1 (GSX1), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu02093C Homo sapiens GS homeobox 1 (GSX1), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_145657.1, 33457325
Length 795 bp
Structure linear
Update Date 22-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens GS homeobox 1 (GSX1), mRNA.
Product GS homeobox 1
Comment

COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AB044157.1.


##Evidence-Data-START## Transcript exon combination :: AB044157.1 [ECO:0000332] ##Evidence-Data-END##

RefSeq NP_663632.1
CDS 49..843
Misc Feature(1)49..108
Misc Feature(2)49..108
Misc Feature(3)490..663
Misc Feature(4)order(490..504,508..510,559..561,577..579,616..618,
Misc Feature(5)order(496..498,505..507,625..627,634..639,646..648)
Exon (1)1..460
Gene:GSX1
Gene Synonym:Gsh-1; GSH1
Exon (2)461..847
Gene:GSX1
Gene Synonym:Gsh-1; GSH1
Translation MPRSFLVDSLVLREAGEKKAPEGSPPPLFPYAVPPPHALHGLSPGACHARKAGLLCVCPL CVTASQLHGPPGPPALPLLKASFPPFGSQYCHAPLGRQHSAVSPGVAHGPAAAAAAAALY QTSYPLPDPRQFHCISVDSSSNQLPSSKRMRTAFTSTQLLELEREFASNMYLSRLRRIEI ATYLNLSEKQVKIWFQNRRVKHKKEGKGSNHRGGGGGGAGGGGSAPQGCKCASLSSAKCS EDDDELPMSPSSSGKDDRDLTVTP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
282+a, gdbSNP:1231058
360+c, tdbSNP:116827208
463+dbSNP:
463+a, cdbSNP:150243944
539+a, gdbSNP:367810809
565+a, tdbSNP:371989788
573+a, gdbSNP:146889423
588+c, tdbSNP:115980353
597+c, tdbSNP:376776365
678+c, tdbSNP:201389990
699+a, gdbSNP:372404864
714+a, gdbSNP:3742111
715+a, gdbSNP:371360518
748+a, cdbSNP:200388174
800+c, tdbSNP:375665681
807+a, gdbSNP:138515715
822+g, tdbSNP:189831013
Gene SymbolGSX1
Gene SynonymGsh-1; GSH1
Chromosome13
Locus Map13q12.2
Title Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan .
Author Low SK, Chung S, Takahashi A, Zembutsu H, Mushiroda T, Kubo M and Nakamura Y.
Journal Cancer Sci. 104 (8), 1074-1082 (2013)
Title Molecular genetic screening of MBS1 locus on chromosome 13 for microdeletions and exclusion of FGF9, GSH1 and CDX2 as causative genes in patients with Moebius syndrome .
Author Uzumcu A, Karaman B, Toksoy G, Uyguner ZO, Candan S, Eris H, Tatli B, Geckinli B, Yuksel A, Kayserili H and Basaran S.
Journal Eur J Med Genet 52 (5), 315-320 (2009)
Title Conduct disorder and ADHD: evaluation of conduct problems as a categorical and quantitative trait in the international multicentre .
Author Anney RJ, Lasky-Su J, O'Dushlaine C, Kenny E, Neale BM, Mulligan A, Franke B, Zhou K, Chen W, Christiansen H, Arias-Vasquez A, Banaschewski T, Buitelaar J, Ebstein R, Miranda A, Mulas F, Oades RD, Roeyers H, Rothenberger A, Sergeant J, Sonuga-Barke E, Steinhausen H, Asherson P, Faraone SV and Gill M.
Journal Am. J. Med. Genet. B Neuropsychiatr. Genet. 147B (8), 1369-1378 (2008)
Title The DNA sequence and analysis of human chromosome 13 .
Author Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S, Jones MC, Keenan SJ, Oliver K, Scott CE, Ainscough R, Almeida JP, Ambrose KD, Andrews DT, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Bannerjee R, Barlow KF, Bates K, Beasley H, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burrill W, Carder C, Carter NP, Chapman JC, Clamp ME, Clark SY, Clarke G, Clee CM, Clegg SC, Cobley V, Collins JE, Corby N, Coville GJ, Deloukas P, Dhami P, Dunham I, Dunn M, Earthrowl ME, Ellington AG, Faulkner L, Frankish AG, Frankland J, French L, Garner P, Garnett J, Gilbert JG, Gilson CJ, Ghori J, Grafham DV, Gribble SM, Griffiths C, Hall RE, Hammond S, Harley JL, Hart EA, Heath PD, Howden PJ, Huckle EJ, Hunt PJ, Hunt AR, Johnson C, Johnson D, Kay M, Kimberley AM, King A, Laird GK, Langford CJ, Lawlor S, Leongamornlert DA, Lloyd DM, Lloyd C, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, McLaren SJ, McMurray A, Milne S, Moore MJ, Nickerson T, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter KM, Rice CM, Searle S, Sehra HK, Shownkeen R, Skuce CD, Smith M, Steward CA, Sycamore N, Tester J, Thomas DW, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Wilming L, Wray PW, Wright MW, Young L, Coulson A, Durbin R, Hubbard T, Sulston JE, Beck S, Bentley DR, Rogers J and Ross MT.
Journal Nature 428 (6982), 522-528 (2004)
Title Homeobox protein Gsh-1-dependent regulation of the rat GHRH gene promoter .
Author Mutsuga N, Iwasaki Y, Morishita M, Nomura A, Yamamori E, Yoshida M, Asai M, Ozaki N, Kambe F, Seo H, Oiso Y and Saito H.
Journal Mol. Endocrinol. 15 (12), 2149-2156 (2001)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.