• THAT   AND
  • THAT   AND


Homo sapiens TRAF3 interacting protein 2 (TRAF3IP2), transcript variant 2, mRNA.


RefSeq Accession Definition Sequence Price Select
NM_147686 Homo sapiens TRAF3 interacting protein 2 (TRAF3IP2), transcript variant 2, mRNA. Full Lenth $773.43
ORF Sequence $492.42


RefSeq Version NM_147686.2, 256017206
Length 2667 bp
Structure linear
Update Date 12-MAR-2011
Organism Homo sapiens (human)
Definition Homo sapiens TRAF3 interacting protein 2 (TRAF3IP2), transcript variant 2, mRNA.
Product adapter protein CIKS isoform 2
Comment

Summary: This gene encodes a protein involved in regulating responses to cytokines by members of the Rel/NF-kappaB transcription factor family. These factors play a central role in innate immunity in response to pathogens, inflammatory signals and stress. This gene product interacts with TRAF proteins (tumor necrosis factor receptor-associated factors) and either I-kappaB kinase or MAP kinase to activate either NF-kappaB or Jun kinase. Several alternative transcripts encoding different isoforms have been identified. Another transcript, which does not encode a protein and is transcribed in the opposite orientation, has been identified. Overexpression of this transcript has been shown to reduce expression of at least one of the protein encoding transcripts, suggesting it has a regulatory role in the expression of this gene. [provided by RefSeq].


Transcript Variant: This variant (2) encodes the longest isoform (2).

RefSeq NP_679211.2
CDS 505..2202
Exon (1)1..496
Exon (2)1..496
Exon (3)497..1333
Exon (4)1334..1526
Exon (5)1527..1705
Exon (6)1706..1794
Exon (7)1795..1863
Exon (8)1864..1980
Exon (9)1981..2055
Exon (10)2056..2667
Translation MNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPTMLHNSSGDF SQAHSTLKLANHQRPVSRQVTCLRTQVLEDSEDSFCRRHPGLGKAFPSGCSAVSEPASES VVGALPAEHQFSFMEKRNQWLVSQLSAASPDTGHDSDKSDQSLPNASADSLGGSQEMVQR PQPHRNRAGLDLPTIDTGYDSQPQDVLGIRQLERPLPLTSVCYPQDLPRPLRSREFPQFE PQRYPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPRAAYQQVIQPALPGQPLP GASVRGLHPVQKVILNYPSPWDHEERPAQRDCSFPGLPRHQDQPHHQPPNRAGAPGESLE CPAELRPQVPQPPSPAAVPRPPSNPPARGTLKTSNLPEELRKVFITYSMDTAMEVVKFVN FLLVNGFQTAIDIFEDRIRGIDIIKWMERYLRDKTVMIIVAISPKYKQDVEGAESQLDED EHGLHTKYIHRMMQIEFIKQGSMNFRFIPVLFPNAKKEHVPTWLQNTHVYSWPKNKKNIL LRLLREEEYVAPPRGPLPTLQVVPL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(235)-g, adbSNP:78707591
complement(532)-t, cdbSNP:33980500
complement(724)-g, adbSNP:13190932
complement(736)-g, cdbSNP:73764462
complement(785)-t, cdbSNP:61756667
1473+a, cdbSNP:1043730
complement(1485)-g, adbSNP:112036127
complement(1509)-t, cdbSNP:117922343
complement(1737)-t, adbSNP:61757647
complement(1921)-t, cdbSNP:111815306
complement(2505)-g, adbSNP:57533271
Gene SymbolTRAF3IP2
Gene SynonymACT1; C6orf2; C6orf4; C6orf5; C6orf6; CIKS; DKFZp586G0522; MGC3581
Chromosome6
Locus Map6q21
All Transcripts NM_147686 , NM_001164282 , NM_001164281 , NM_001164283
Title A genome-wide association study identifies new psoriasis susceptibility loci and an interaction between HLA-C and ERAP1 .
Author Strange,A., Capon,F., Spencer,C.C., Knight,J., Weale,M.E., Allen,M.H., Barton,A., Band,G., Bellenguez,C., Bergboer,J.G., Blackwell,J.M., Bramon,E., Bumpstead,S.J., Casas,J.P., Cork,M.J., Corvin,A., Deloukas,P., Dilthey,A., Duncanson,A., Edkins,S., Estivill,X., Fitzgerald,O., Freeman,C., Giardina,E., Gray,E., Hofer,A., Huffmeier,U., Hunt,S.E., Irvine,A.D., Jankowski,J., Kirby,B., Langford,C., Lascorz,J., Leman,J., Leslie,S., Mallbris,L., Markus,H.S., Mathew,C.G., McLean,W.H., McManus,R., Mossner,R., Moutsianas,L., Naluai,A.T., Nestle,F.O., Novelli,G., Onoufriadis,A., Palmer,C.N., Perricone,C., Pirinen,M., Plomin,R., Potter,S.C., Pujol,R.M., Rautanen,A., Riveira-Munoz,E., Ryan,A.W., Salmhofer,W., Samuelsson,L., Sawcer,S.J., Schalkwijk,J., Smith,C.H., Stahle,M., Su,Z., Tazi-Ahnini,R., Traupe,H., Viswanathan,A.C., Warren,R.B., Weger,W., Wolk,K., Wood,N., Worthington,J., Young,H.S., Zeeuwen,P.L., Hayday,A., Burden,A.D., Griffiths,C.E., Kere,J., Reis,A., McVean,G., Evans,D.M., Brown,M.A., Barker,J.N., Peltonen,L., Donnelly,P. and Trembath,R.C.
Journal Nat. Genet. 42 (11), 985-990 (2010)
Title Genome-wide association study identifies a psoriasis susceptibility locus at TRAF3IP2 .
Author Ellinghaus,E., Ellinghaus,D., Stuart,P.E., Nair,R.P., Debrus,S., Raelson,J.V., Belouchi,M., Fournier,H., Reinhard,C., Ding,J., Li,Y., Tejasvi,T., Gudjonsson,J., Stoll,S.W., Voorhees,J.J., Lambert,S., Weidinger,S., Eberlein,B., Kunz,M., Rahman,P., Gladman,D.D., Gieger,C., Wichmann,H.E., Karlsen,T.H., Mayr,G., Albrecht,M., Kabelitz,D., Mrowietz,U., Abecasis,G.R., Elder,J.T., Schreiber,S., Weichenthal,M. and Franke,A.
Journal Nat. Genet. 42 (11), 991-995 (2010)
Title Common variants at TRAF3IP2 are associated with susceptibility to psoriatic arthritis and psoriasis .
Author Huffmeier,U., Uebe,S., Ekici,A.B., Bowes,J., Giardina,E., Korendowych,E., Juneblad,K., Apel,M., McManus,R., Ho,P., Bruce,I.N., Ryan,A.W., Behrens,F., Lascorz,J., Bohm,B., Traupe,H., Lohmann,J., Gieger,C., Wichmann,H.E., Herold,C., Steffens,M., Klareskog,L., Wienker,T.F., Fitzgerald,O., Alenius,G.M., McHugh,N.J., Novelli,G., Burkhardt,H., Barton,A. and Reis,A.
Journal Nat. Genet. 42 (11), 996-999 (2010)
Title The adaptor molecule Act1 regulates BAFF responsiveness and self-reactive B cell selection during transitional B cell maturation .
Author Giltiay,N.V., Lu,Y., Allman,D., Jorgensen,T.N. and Li,X.
Journal J. Immunol. 185 (1), 99-109 (2010)
Title Act1, a U-box E3 ubiquitin ligase for IL-17 signaling .
Author Liu,C., Qian,W., Qian,Y., Giltiay,N.V., Lu,Y., Swaidani,S., Misra,S., Deng,L., Chen,Z.J. and Li,X.
Journal Sci Signal 2 (92), RA63 (2009)
Title Identification of alternatively spliced Act1 and implications for its roles in oncogenesis .
Author Xia,Y.F., Li,Y.D., Li,X. and Geng,J.G.
Journal Biochem. Biophys. Res. Commun. 296 (2), 406-412 (2002)
Title Role of NF kappa B activator Act1 in CD40-mediated signaling in epithelial cells .
Author Qian,Y., Zhao,Z., Jiang,Z. and Li,X.
Journal Proc. Natl. Acad. Sci. U.S.A. 99 (14), 9386-9391 (2002)
Title CIKS, a connection to Ikappa B kinase and stress-activated protein kinase .
Author Leonardi,A., Chariot,A., Claudio,E., Cunningham,K. and Siebenlist,U.
Journal Proc. Natl. Acad. Sci. U.S.A. 97 (19), 10494-10499 (2000)
Title Act1, an NF-kappa B-activating protein .
Author Li,X., Commane,M., Nie,H., Hua,X., Chatterjee-Kishore,M., Wald,D., Haag,M. and Stark,G.R.
Journal Proc. Natl. Acad. Sci. U.S.A. 97 (19), 10489-10493 (2000)
Title Cloning and characterization of two overlapping genes in a subregion at 6q21 involved in replicative senescence and schizophrenia .
Author Morelli,C., Magnanini,C., Mungall,A.J., Negrini,M. and Barbanti-Brodano,G.
Journal Gene 252 (1-2), 217-225 (2000)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878