• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens TRAF3 interacting protein 2 (TRAF3IP2), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_147686 Homo sapiens TRAF3 interacting protein 2 (TRAF3IP2), transcript variant 2, mRNA. GenEZ ORF Cloning On-demand $699.00 18

*Business Day

Related Services

RefSeq Version NM_147686.3, 373938458
Length 6244 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens TRAF3 interacting protein 2 (TRAF3IP2), transcript variant 2, mRNA.
Product adapter protein CIKS isoform 2
Comment

Summary: This gene encodes a protein involved in regulating responses to cytokines by members of the Rel/NF-kappaB transcription factor family. These factors play a central role in innate immunity in response to pathogens, inflammatory signals and stress. This gene product interacts with TRAF proteins (tumor necrosis factor receptor-associated factors) and either I-kappaB kinase or MAP kinase to activate either NF-kappaB or Jun kinase. Several alternative transcripts encoding different isoforms have been identified. Another transcript, which does not encode a protein and is transcribed in the opposite orientation, has been identified. Overexpression of this transcript has been shown to reduce expression of at least one of the protein encoding transcripts, suggesting it has a regulatory role in the expression of this gene. [provided by RefSeq, Aug 2009].


Transcript Variant: This variant (2) encodes the longest isoform (2).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_679211.2
CDS 508..2205
Misc Feature(1)496..498
Misc Feature(2)<1399..1674
Misc Feature(3)<1399..1674
Misc Feature(4)1708..2136
Exon (1)1..499
Gene:TRAF3IP2
Gene Synonym:ACT1; C6orf2; C6orf4; C6orf5; C6orf6; CANDF8; CIKS; PSORS13
Exon (2)500..1336
Gene:TRAF3IP2
Gene Synonym:ACT1; C6orf2; C6orf4; C6orf5; C6orf6; CANDF8; CIKS; PSORS13
Exon (3)1337..1529
Gene:TRAF3IP2
Gene Synonym:ACT1; C6orf2; C6orf4; C6orf5; C6orf6; CANDF8; CIKS; PSORS13
Exon (4)1530..1708
Gene:TRAF3IP2
Gene Synonym:ACT1; C6orf2; C6orf4; C6orf5; C6orf6; CANDF8; CIKS; PSORS13
Exon (5)1709..1797
Gene:TRAF3IP2
Gene Synonym:ACT1; C6orf2; C6orf4; C6orf5; C6orf6; CANDF8; CIKS; PSORS13
Exon (6)1798..1866
Gene:TRAF3IP2
Gene Synonym:ACT1; C6orf2; C6orf4; C6orf5; C6orf6; CANDF8; CIKS; PSORS13
Exon (7)1867..1983
Gene:TRAF3IP2
Gene Synonym:ACT1; C6orf2; C6orf4; C6orf5; C6orf6; CANDF8; CIKS; PSORS13
Exon (8)1984..2058
Gene:TRAF3IP2
Gene Synonym:ACT1; C6orf2; C6orf4; C6orf5; C6orf6; CANDF8; CIKS; PSORS13
Exon (9)2059..6232
Gene:TRAF3IP2
Gene Synonym:ACT1; C6orf2; C6orf4; C6orf5; C6orf6; CANDF8; CIKS; PSORS13
Translation MNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPTMLHNSSGDF SQAHSTLKLANHQRPVSRQVTCLRTQVLEDSEDSFCRRHPGLGKAFPSGCSAVSEPASES VVGALPAEHQFSFMEKRNQWLVSQLSAASPDTGHDSDKSDQSLPNASADSLGGSQEMVQR PQPHRNRAGLDLPTIDTGYDSQPQDVLGIRQLERPLPLTSVCYPQDLPRPLRSREFPQFE PQRYPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPRAAYQQVIQPALPGQPLP GASVRGLHPVQKVILNYPSPWDHEERPAQRDCSFPGLPRHQDQPHHQPPNRAGAPGESLE CPAELRPQVPQPPSPAAVPRPPSNPPARGTLKTSNLPEELRKVFITYSMDTAMEVVKFVN FLLVNGFQTAIDIFEDRIRGIDIIKWMERYLRDKTVMIIVAISPKYKQDVEGAESQLDED EHGLHTKYIHRMMQIEFIKQGSMNFRFIPVLFPNAKKEHVPTWLQNTHVYSWPKNKKNIL LRLLREEEYVAPPRGPLPTLQVVPL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(238)-dbSNP:
complement(238)-g, adbSNP:78707591
513+c, tdbSNP:1127423
complement(515)-t, cdbSNP:148778036
complement(529)-t, cdbSNP:377259004
complement(535)-t, cdbSNP:33980500
complement(590)-g, adbSNP:369345925
complement(611..612)-, ggtdbSNP:142054894
complement(623)-g, adbSNP:200469044
complement(636)-t, gdbSNP:199642555
complement(642)-g, cdbSNP:375324881
complement(674)-g, adbSNP:368757476
complement(678)-g, adbSNP:144366791
complement(679)-t, cdbSNP:201280730
complement(698)-t, gdbSNP:149246847
complement(727)-g, adbSNP:13190932
complement(728)-t, cdbSNP:149247775
complement(739)-g, cdbSNP:73764462
complement(744)-g, cdbSNP:150601696
complement(757)-g, adbSNP:376682410
complement(758)-t, cdbSNP:141777182
complement(766)-t, cdbSNP:138172773
complement(778)-t, cdbSNP:372576606
complement(786)-g, adbSNP:368701195
complement(788)-t, cdbSNP:61756667
complement(814)-t, cdbSNP:376351152
complement(947)-g, adbSNP:141508826
complement(983)-g, adbSNP:372064320
complement(995)-g, adbSNP:368618035
complement(1003)-c, adbSNP:373943436
complement(1004)-g, adbSNP:371756748
complement(1011)-t, gdbSNP:367701538
complement(1045)-g, adbSNP:141283234
complement(1049)-g, adbSNP:376991338
complement(1073)-t, cdbSNP:138401155
complement(1087)-t, cdbSNP:147059564
complement(1148)-t, cdbSNP:181942095
complement(1156)-t, gdbSNP:139282334
complement(1164)-g, adbSNP:189180850
complement(1168)-t, cdbSNP:145697646
complement(1198)-g, adbSNP:149860754
complement(1216)-g, adbSNP:368264858
complement(1254)-t, cdbSNP:141106401
complement(1265)-g, cdbSNP:146627823
complement(1320)-g, adbSNP:370730037
complement(1326)-g, cdbSNP:144405088
complement(1376)-dbSNP:
complement(1376)-c, adbSNP:200074354
complement(1400)-t, gdbSNP:139657171
complement(1464)-t, gdbSNP:146226365
1476+a, cdbSNP:1043730
complement(1476)-c, adbSNP:386512964
complement(1488)-g, adbSNP:112036127
complement(1491)-t, cdbSNP:369210680
complement(1512)-t, cdbSNP:117922343
complement(1514)-t, cdbSNP:200547309
complement(1527)-g, adbSNP:200703649
complement(1565)-dbSNP:
complement(1565)-t, cdbSNP:148619849
complement(1571)-g, adbSNP:143865750
complement(1626)-t, cdbSNP:370011231
complement(1652)-g, adbSNP:149449506
complement(1691)-t, cdbSNP:139767840
complement(1740)-dbSNP:
complement(1740)-t, adbSNP:61757647
complement(1745)-g, adbSNP:372899704
complement(1753)-g, cdbSNP:200053958
complement(1804)-dbSNP:
complement(1804)-t, cdbSNP:375272521
complement(1829)-g, adbSNP:138824557
1844+g, tdbSNP:11540679
complement(1851)-t, g, cdbSNP:200991285
complement(1852)-g, adbSNP:200246882
complement(1872)-dbSNP:
complement(1872)-g, adbSNP:200213270
complement(1884)-g, adbSNP:371382152
complement(1914)-g, adbSNP:150436455
complement(1924)-t, cdbSNP:111815306
complement(1931)-g, adbSNP:367784420
complement(1941)-g, adbSNP:144166946
complement(1942)-t, cdbSNP:149504543
complement(1947)-c, adbSNP:141459820
complement(2063)-dbSNP:
complement(2063)-t, cdbSNP:377585744
2087+c, tdbSNP:397518485
complement(2090)-t, cdbSNP:202090066
complement(2121)-g, adbSNP:186097801
complement(2131)-g, adbSNP:148316010
complement(2199)-g, cdbSNP:143248990
complement(2209)-g, adbSNP:370109607
complement(2397)-g, adbSNP:138485893
complement(2406)-t, adbSNP:373361936
complement(2452)-t, cdbSNP:181849404
complement(2508)-g, adbSNP:57533271
complement(2727)-g, adbSNP:9487669
complement(2762)-c, adbSNP:190544260
complement(2814..2815)-, ctdbSNP:397959916
complement(2815..2816)-, ctdbSNP:376718827
complement(2816..2817)-, ctdbSNP:57931464
complement(2890)-t, cdbSNP:9384797
complement(2967)-t, cdbSNP:372268916
complement(3016)-g, adbSNP:140677458
complement(3085)-t, cdbSNP:56410656
complement(3107)-g, cdbSNP:151268687
complement(3109)-t, cdbSNP:377608286
complement(3153)-g, adbSNP:368592340
complement(3154)-g, adbSNP:192431256
complement(3234)-t, cdbSNP:11153297
complement(3314)-t, cdbSNP:142369053
complement(3612)-t, cdbSNP:149136178
complement(3683)-g, adbSNP:145220678
complement(3699..3700)-, tdbSNP:144962646
complement(3816)-g, adbSNP:188240738
complement(4109)-t, cdbSNP:183487901
complement(4163)-, tdbSNP:397888583
complement(4225)-g, adbSNP:114806915
complement(4370)-c, adbSNP:374572454
complement(4428)-g, adbSNP:191696872
complement(4436)-t, gdbSNP:187010950
complement(4451)-g, adbSNP:201800803
complement(4470)-c, adbSNP:370896152
complement(4559)-t, cdbSNP:149985533
complement(4603..4609)-, cctatagdbSNP:201818157
complement(4757)-g, adbSNP:183607050
complement(4837)-c, adbSNP:374060782
complement(4871..4872)-, gttdbSNP:34539212
complement(4874..4875)-, gttdbSNP:201372735
complement(4885)-t, cdbSNP:41289894
complement(4920)-g, adbSNP:374986461
complement(5126)-g, adbSNP:193081739
complement(5190)-g, adbSNP:926241
complement(5198)-g, adbSNP:111496051
complement(5250)-g, adbSNP:188896539
complement(5303)-c, adbSNP:184152004
complement(5360)-g, adbSNP:147436836
complement(5395..5396)-, gtdbSNP:146668280
complement(5415..5416)-, gtdbSNP:373509113
complement(5416)-g, adbSNP:190908201
complement(5489..5490)-, aadbSNP:66883611
complement(5492)-, adbSNP:35454154
complement(5593)-t, cdbSNP:369258405
complement(5724)-g, adbSNP:369773556
complement(5750)-t, gdbSNP:79219929
complement(5769)-t, cdbSNP:185339622
complement(5802)-c, adbSNP:182094502
complement(5828)-t, cdbSNP:10484479
complement(5850)-t, adbSNP:190424035
complement(5852)-t, cdbSNP:368098813
complement(5860)-g, adbSNP:370720926
complement(5874)-g, adbSNP:374520422
complement(5894)-g, adbSNP:186483827
complement(5920..5921)-, agtcdbSNP:375881030
complement(5968)-t, cdbSNP:181857341
complement(5986)-t, cdbSNP:375036032
complement(5998)-t, cdbSNP:150533032
complement(6007)-g, adbSNP:190151980
complement(6109)-g, adbSNP:75432622
complement(6214)-t, gdbSNP:112217872
Gene SymbolTRAF3IP2
Gene SynonymACT1; C6orf2; C6orf4; C6orf5; C6orf6; CANDF8; CIKS; PSORS13
Chromosome6
Locus Map6q21
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001164281 Homo sapiens TRAF3 interacting protein 2 (TRAF3IP2), transcript variant 3, mRNA. On-demand $699.00 18
NM_001164283 Homo sapiens TRAF3 interacting protein 2 (TRAF3IP2), transcript variant 5, mRNA. On-demand $299.00 14
NM_147686 Homo sapiens TRAF3 interacting protein 2 (TRAF3IP2), transcript variant 2, mRNA. On-demand $699.00 18
XM_006715319 PREDICTED: Homo sapiens TRAF3 interacting protein 2 (TRAF3IP2), transcript variant X1, mRNA. On-demand $299.00 14
Title An ACT1 mutation selectively abolishes interleukin-17 responses in humans with chronic mucocutaneous candidiasis .
Author Boisson B, Wang C, Pedergnana V, Wu L, Cypowyj S, Rybojad M, Belkadi A, Picard C, Abel L, Fieschi C, Puel A, Li X and Casanova JL.
Journal Immunity 39 (4), 676-686 (2013)
Title Act1 mediates IL-17-induced EAE pathogenesis selectively in NG2+ glial cells .
Author Kang Z, Wang C, Zepp J, Wu L, Sun K, Zhao J, Chandrasekharan U, DiCorleto PE, Trapp BD, Ransohoff RM and Li X.
Journal Nat. Neurosci. 16 (10), 1401-1408 (2013)
Title TRAF3IP2 gene and systemic lupus erythematosus: association with disease susceptibility and pericarditis development .
Author Perricone C, Ciccacci C, Ceccarelli F, Di Fusco D, Spinelli FR, Cipriano E, Novelli G, Valesini G, Conti F and Borgiani P.
Journal Immunogenetics 65 (10), 703-709 (2013)
Title IL-17 receptor adaptor protein Act1/CIKS plays an evolutionarily conserved role in antiviral signaling .
Author Ryzhakov G, Blazek K, Lai CC and Udalova IA.
Journal J. Immunol. 189 (10), 4852-4858 (2012)
Title Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease .
Author Jostins L, Ripke S, Weersma RK, Duerr RH, McGovern DP, Hui KY, Lee JC, Schumm LP, Sharma Y, Anderson CA, Essers J, Mitrovic M, Ning K, Cleynen I, Theatre E, Spain SL, Raychaudhuri S, Goyette P, Wei Z, Abraham C, Achkar JP, Ahmad T, Amininejad L, Ananthakrishnan AN, Andersen V, Andrews JM, Baidoo L, Balschun T, Bampton PA, Bitton A, Boucher G, Brand S, Buning C, Cohain A, Cichon S, D'Amato M, De Jong D, Devaney KL, Dubinsky M, Edwards C, Ellinghaus D, Ferguson LR, Franchimont D, Fransen K, Gearry R, Georges M, Gieger C, Glas J, Haritunians T, Hart A, Hawkey C, Hedl M, Hu X, Karlsen TH, Kupcinskas L, Kugathasan S, Latiano A, Laukens D, Lawrance IC, Lees CW, Louis E, Mahy G, Mansfield J, Morgan AR, Mowat C, Newman W, Palmieri O, Ponsioen CY, Potocnik U, Prescott NJ, Regueiro M, Rotter JI, Russell RK, Sanderson JD, Sans M, Satsangi J, Schreiber S, Simms LA, Sventoraityte J, Targan SR, Taylor KD, Tremelling M, Verspaget HW, De Vos M, Wijmenga C, Wilson DC, Winkelmann J, Xavier RJ, Zeissig S, Zhang B, Zhang CK, Zhao H, Silverberg MS, Annese V, Hakonarson H, Brant SR, Radford-Smith G, Mathew CG, Rioux JD, Schadt EE, Daly MJ, Franke A, Parkes M, Vermeire S, Barrett JC and Cho JH.
Journal Nature 491 (7422), 119-124 (2012)
Title Identification of alternatively spliced Act1 and implications for its roles in oncogenesis .
Author Xia YF, Li YD, Li X and Geng JG.
Journal Biochem. Biophys. Res. Commun. 296 (2), 406-412 (2002)
Title Role of NF kappa B activator Act1 in CD40-mediated signaling in epithelial cells .
Author Qian Y, Zhao Z, Jiang Z and Li X.
Journal Proc. Natl. Acad. Sci. U.S.A. 99 (14), 9386-9391 (2002)
Title CIKS, a connection to Ikappa B kinase and stress-activated protein kinase .
Author Leonardi A, Chariot A, Claudio E, Cunningham K and Siebenlist U.
Journal Proc. Natl. Acad. Sci. U.S.A. 97 (19), 10494-10499 (2000)
Title Act1, an NF-kappa B-activating protein .
Author Li X, Commane M, Nie H, Hua X, Chatterjee-Kishore M, Wald D, Haag M and Stark GR.
Journal Proc. Natl. Acad. Sci. U.S.A. 97 (19), 10489-10493 (2000)
Title Cloning and characterization of two overlapping genes in a subregion at 6q21 involved in replicative senescence and schizophrenia .
Author Morelli C, Magnanini C, Mungall AJ, Negrini M and Barbanti-Brodano G.
Journal Gene 252 (1-2), 217-225 (2000)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.