• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens carnitine palmitoyltransferase 1B (muscle) (CPT1B), transcript variant 3, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu10117 Homo sapiens carnitine palmitoyltransferase 1B (muscle) (CPT1B), transcript variant 3, mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu10117C Homo sapiens carnitine palmitoyltransferase 1B (muscle) (CPT1B), transcript variant 3, mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_152246.2, 311213910
Length 2319 bp
Structure linear
Update Date 15-MAR-2014
Organism Homo sapiens (human)
Definition Homo sapiens carnitine palmitoyltransferase 1B (muscle) (CPT1B), transcript variant 3, mRNA.
Product carnitine O-palmitoyltransferase 1, muscle isoform isoform a
Comment

Summary: The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-chain fatty acyl-CoAs from the cytoplasm into the mitochondria. Multiple transcript variants encoding different isoforms have been found for this gene, and read-through transcripts are expressed from the upstream locus that include exons from this gene. [provided by RefSeq, Jun 2009].


Transcript Variant: This variant (3) differs in the 3' UTR compared to variant 1. Variants 1, 2, 3, 6, and 8 all encode isoform a.

RefSeq NP_689452.1
CDS 100..2418
Misc Feature(1)16..18
Misc Feature(2)16..18
Misc Feature(3)28
Misc Feature(4)241..318
Misc Feature(5)241..318
Misc Feature(6)406..465
Misc Feature(7)613..2388
Misc Feature(8)1762..1800
Exon (1)1..80
Gene:CPT1B
Gene Synonym:CPT1-M; CPT1M; CPTI; CPTI-M; M-CPT1; MCCPT1; MCPT1
Exon (2)81..240
Gene:CPT1B
Gene Synonym:CPT1-M; CPT1M; CPTI; CPTI-M; M-CPT1; MCCPT1; MCPT1
Exon (3)241..380
Gene:CPT1B
Gene Synonym:CPT1-M; CPT1M; CPTI; CPTI-M; M-CPT1; MCCPT1; MCPT1
Exon (4)381..558
Gene:CPT1B
Gene Synonym:CPT1-M; CPT1M; CPTI; CPTI-M; M-CPT1; MCCPT1; MCPT1
Exon (5)559..660
Gene:CPT1B
Gene Synonym:CPT1-M; CPT1M; CPTI; CPTI-M; M-CPT1; MCCPT1; MCPT1
Exon (6)661..798
Gene:CPT1B
Gene Synonym:CPT1-M; CPT1M; CPTI; CPTI-M; M-CPT1; MCCPT1; MCPT1
Exon (7)799..876
Gene:CPT1B
Gene Synonym:CPT1-M; CPT1M; CPTI; CPTI-M; M-CPT1; MCCPT1; MCPT1
Exon (8)877..984
Gene:CPT1B
Gene Synonym:CPT1-M; CPT1M; CPTI; CPTI-M; M-CPT1; MCCPT1; MCPT1
Exon (9)985..1069
Gene:CPT1B
Gene Synonym:CPT1-M; CPT1M; CPTI; CPTI-M; M-CPT1; MCCPT1; MCPT1
Exon (10)1070..1265
Gene:CPT1B
Gene Synonym:CPT1-M; CPT1M; CPTI; CPTI-M; M-CPT1; MCCPT1; MCPT1
Exon (11)1266..1451
Gene:CPT1B
Gene Synonym:CPT1-M; CPT1M; CPTI; CPTI-M; M-CPT1; MCCPT1; MCPT1
Exon (12)1452..1557
Gene:CPT1B
Gene Synonym:CPT1-M; CPT1M; CPTI; CPTI-M; M-CPT1; MCCPT1; MCPT1
Exon (13)1558..1674
Gene:CPT1B
Gene Synonym:CPT1-M; CPT1M; CPTI; CPTI-M; M-CPT1; MCCPT1; MCPT1
Exon (14)1675..1839
Gene:CPT1B
Gene Synonym:CPT1-M; CPT1M; CPTI; CPTI-M; M-CPT1; MCCPT1; MCPT1
Exon (15)1840..1974
Gene:CPT1B
Gene Synonym:CPT1-M; CPT1M; CPTI; CPTI-M; M-CPT1; MCCPT1; MCPT1
Exon (16)1975..2127
Gene:CPT1B
Gene Synonym:CPT1-M; CPT1M; CPTI; CPTI-M; M-CPT1; MCCPT1; MCPT1
Exon (17)2128..2241
Gene:CPT1B
Gene Synonym:CPT1-M; CPT1M; CPTI; CPTI-M; M-CPT1; MCCPT1; MCPT1
Exon (18)2242..2334
Gene:CPT1B
Gene Synonym:CPT1-M; CPT1M; CPTI; CPTI-M; M-CPT1; MCCPT1; MCPT1
Exon (19)2335..2420
Gene:CPT1B
Gene Synonym:CPT1-M; CPT1M; CPTI; CPTI-M; M-CPT1; MCCPT1; MCPT1
Exon (20)2421..2641
Gene:CPT1B
Gene Synonym:CPT1-M; CPT1M; CPTI; CPTI-M; M-CPT1; MCCPT1; MCPT1
Translation MAEAHQAVAFQFTVTPDGVDFRLSREALKHVYLSGINSWKKRLIRIKNGILRGVYPGSPT SWLVVIMATVGSSFCNVDISLGLVSCIQRCLPQGCGPYQTPQTRALLSMAIFSTGVWVTG IFFFRQTLKLLLCYHGWMFEMHGKTSNLTRIWAMCIRLLSSRHPMLYSFQTSLPKLPVPR VSATIQRYLESVRPLLDDEEYYRMELLAKEFQDKTAPRLQKYLVLKSWWASNYVSDWWEE YIYLRGRSPLMVNSNYYVMDLVLIKNTDVQAARLGNIIHAMIMYRRKLDREEIKPVMALG IVPMCSYQMERMFNTTRIPGKDTDVLQHLSDSRHVAVYHKGRFFKLWLYEGARLLKPQDL EMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAALEAIERAAFFVA LDEESYSYDPEDEASLSLYGKALLHGNCYNRWFDKSFTLISFKNGQLGLNAEHAWADAPI IGHLWEFVLGTDSFHLGYTETGHCLGKPNPALAPPTRLQWDIPKQCQAVIESSYQVAKAL ADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDRGKFCLTYEASMTRMFREG RTETVRSCTSESTAFVQAMMEGSHTKADLRDLFQKAAKKHQNMYRLAMTGAGIDRHLFCL YLVSKYLGVSSPFLAEVLSEPWRLSTSQIPQSQIRMFDPEQHPNHLGAGGGFGPVADDGY GVSYMIAGENTIFFHISSKFSSSETNAQRFGNHIRKALLDIADLFQVPKAYS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(84)-dbSNP:
complement(84)-g, adbSNP:6520157
complement(97)-t, adbSNP:373082174
complement(150)-g, cdbSNP:199821148
complement(152)-t, cdbSNP:368271240
complement(168)-g, adbSNP:374584918
complement(203)-g, cdbSNP:372094766
complement(219)-t, cdbSNP:367742672
complement(249)-dbSNP:
complement(249)-g, adbSNP:146714587
complement(266)-g, adbSNP:374480938
295+a, gdbSNP:3213445
complement(312)-t, adbSNP:376414726
complement(332)-t, gdbSNP:145748704
complement(340)-g, adbSNP:140878554
complement(342)-g, cdbSNP:201984897
complement(352)-t, cdbSNP:146428319
complement(402)-dbSNP:
complement(402)-t, cdbSNP:142502983
complement(441)-c, adbSNP:148805071
complement(455)-g, adbSNP:199841221
complement(456)-t, cdbSNP:145406536
complement(473)-t, cdbSNP:150050955
complement(479)-g, adbSNP:371625675
complement(521)-g, adbSNP:369796629
complement(536)-t, cdbSNP:140085174
complement(568)-dbSNP:
complement(568)-g, adbSNP:370363463
complement(584)-t, cdbSNP:368302579
complement(585)-t, cdbSNP:202135722
complement(622)-t, cdbSNP:182821554
complement(659)-t, cdbSNP:147502032
691+dbSNP:
691+g, tdbSNP:17848455
complement(699)-t, adbSNP:143125736
complement(705)-t, cdbSNP:17848456
complement(718)-g, cdbSNP:370958863
731+a, gdbSNP:75678173
complement(733)-g, adbSNP:377748125
complement(734)-t, cdbSNP:140797488
complement(750)-g, adbSNP:150621657
complement(754)-t, gdbSNP:373379091
complement(794)-t, cdbSNP:370482807
complement(797)-t, cdbSNP:199949985
complement(806)-dbSNP:
complement(806)-t, cdbSNP:112845250
complement(814)-c, adbSNP:111267458
complement(832)-g, adbSNP:374942225
complement(833)-t, cdbSNP:373214555
complement(853)-t, cdbSNP:141837905
complement(859)-t, cdbSNP:148070553
complement(874)-t, gdbSNP:369488131
complement(903)-dbSNP:
complement(903)-t, cdbSNP:17848457
complement(927)-t, gdbSNP:184510872
complement(932)-g, adbSNP:200933686
complement(937)-t, c, adbSNP:201673605
complement(953)-t, cdbSNP:141802871
complement(956)-t, cdbSNP:138696904
complement(963)-t, cdbSNP:375155139
complement(985)-dbSNP:
complement(985)-g, cdbSNP:375539120
complement(1043)-g, cdbSNP:201769569
complement(1053)-g, cdbSNP:370978706
complement(1056)-t, cdbSNP:144743183
1058+a, gdbSNP:2269383
complement(1097)-dbSNP:
complement(1097)-t, cdbSNP:191569295
complement(1101)-g, adbSNP:200798217
complement(1153)-t, cdbSNP:377484724
complement(1157)-t, cdbSNP:144936442
complement(1180)-t, cdbSNP:199498809
complement(1279)-dbSNP:
complement(1279)-g, adbSNP:369593888
complement(1286)-t, cdbSNP:150309698
complement(1297)-g, adbSNP:201454560
complement(1302)-g, adbSNP:200392450
complement(1304..1305)-, agdbSNP:34945006
complement(1345)-t, cdbSNP:140100981
complement(1371)-t, cdbSNP:151130325
complement(1379)-g, cdbSNP:8142477
complement(1382)-t, cdbSNP:141820211
complement(1407)-g, adbSNP:34744246
complement(1429)-g, adbSNP:373936860
complement(1433)-t, adbSNP:144799109
complement(1452)-dbSNP:
complement(1452)-t, cdbSNP:140863538
complement(1456)-g, adbSNP:144280175
complement(1476)-g, cdbSNP:149999532
complement(1521)-t, cdbSNP:112259265
complement(1553)-t, cdbSNP:150817976
complement(1569)-g, adbSNP:200086261
complement(1585)-g, adbSNP:371865628
complement(1596)-t, cdbSNP:201226839
complement(1631)-t, gdbSNP:368305362
complement(1635)-g, adbSNP:200007612
complement(1636)-t, cdbSNP:141870572
complement(1642)-g, adbSNP:71318421
complement(1649)-t, cdbSNP:149756287
complement(1651)-g, cdbSNP:71318420
complement(1683)-dbSNP:
complement(1683)-t, cdbSNP:368775105
1690+a, gdbSNP:470117
complement(1705)-t, cdbSNP:200572653
complement(1716)-t, cdbSNP:142560979
complement(1725)-g, adbSNP:182745269
complement(1728)-g, adbSNP:375480699
complement(1773)-g, adbSNP:148018730
complement(1787)-t, cdbSNP:143499448
complement(1817)-g, adbSNP:148842805
complement(1837)-g, adbSNP:138391114
complement(1838)-t, cdbSNP:145751063
complement(1901)-dbSNP:
complement(1901)-t, cdbSNP:141885850
complement(1906)-g, cdbSNP:147955265
complement(1937)-g, adbSNP:144863640
complement(1938)-t, cdbSNP:142545174
complement(1948)-t, gdbSNP:370319926
complement(1960)-t, cdbSNP:377156417
complement(1976)-dbSNP:
complement(1976)-t, cdbSNP:111375437
complement(1979)-t, gdbSNP:146224883
complement(2026)-t, cdbSNP:371604703
complement(2049)-t, cdbSNP:369404452
complement(2076)-g, cdbSNP:190052870
2090+a, cdbSNP:1804702
complement(2104)-g, cdbSNP:376060651
complement(2136)-dbSNP:
complement(2136)-t, cdbSNP:201695087
complement(2147)-t, cdbSNP:200495991
complement(2190)-g, adbSNP:148525939
complement(2232)-g, adbSNP:201037998
complement(2239)-t, gdbSNP:367724167
complement(2280)-dbSNP:
complement(2280)-t, cdbSNP:144698481
complement(2283)-g, adbSNP:377289863
complement(2284)-t, cdbSNP:114814733
complement(2286)-c, adbSNP:370023022
complement(2291)-g, adbSNP:139996419
complement(2294)-g, adbSNP:199944176
complement(2313)-g, cdbSNP:374511828
2337+dbSNP:
2337+c, tdbSNP:17848472
complement(2338)-t, cdbSNP:201978200
complement(2344)-g, adbSNP:375316854
complement(2359)-t, cdbSNP:368899928
complement(2363)-t, cdbSNP:200771908
complement(2381)-g, adbSNP:142616949
complement(2409)-g, cdbSNP:138045495
complement(2413)-t, gdbSNP:150762471
2415+a, cdbSNP:1803460
complement(2420)-t, cdbSNP:372013272
complement(2443)-t, cdbSNP:386608615
2443+c, tdbSNP:7238
2474+g, tdbSNP:12288
2479+a, gdbSNP:15195
complement(2553)-g, adbSNP:368737580
complement(2574)-t, cdbSNP:184896296
complement(2575)-g, adbSNP:373756467
Gene SymbolCPT1B
Gene SynonymCPT1-M; CPT1M; CPTI; CPTI-M; M-CPT1; MCCPT1; MCPT1
Chromosome22
Locus Map22q13.33
Title Multiethnic meta-analysis of genome-wide association studies in >100 000 subjects identifies 23 fibrinogen-associated Loci but no strong evidence of a causal association between circulating fibrinogen and cardiovascular disease .
Author Sabater-Lleal M, Huang J, Chasman D, Naitza S, Dehghan A, Johnson AD, Teumer A, Reiner AP, Folkersen L, Basu S, Rudnicka AR, Trompet S, Malarstig A, Baumert J, Bis JC, Guo X, Hottenga JJ, Shin SY, Lopez LM, Lahti J, Tanaka T, Yanek LR, Oudot-Mellakh T, Wilson JF, Navarro P, Huffman JE, Zemunik T, Redline S, Mehra R, Pulanic D, Rudan I, Wright AF, Kolcic I, Polasek O, Wild SH, Campbell H, Curb JD, Wallace R, Liu S, Eaton CB, Becker DM, Becker LC, Bandinelli S, Raikkonen K, Widen E, Palotie A, Fornage M, Green D, Gross M, Davies G, Harris SE, Liewald DC, Starr JM, Williams FM, Grant PJ, Spector TD, Strawbridge RJ, Silveira A, Sennblad B, Rivadeneira F, Uitterlinden AG, Franco OH, Hofman A, van Dongen J, Willemsen G, Boomsma DI, Yao J, Swords Jenny N, Haritunians T, McKnight B, Lumley T, Taylor KD, Rotter JI, Psaty BM, Peters A, Gieger C, Illig T, Grotevendt A, Homuth G, Volzke H, Kocher T, Goel A, Franzosi MG, Seedorf U, Clarke R, Steri M, Tarasov KV, Sanna S, Schlessinger D, Stott DJ, Sattar N, Buckley BM, Rumley A, Lowe GD, McArdle WL, Chen MH, Tofler GH, Song J, Boerwinkle E, Folsom AR, Rose LM, Franco-Cereceda A, Teichert M, Ikram MA, Mosley TH, Bevan S, Dichgans M, Rothwell PM, Sudlow CL, Hopewell JC, Chambers JC, Saleheen D, Kooner JS, Danesh J, Nelson CP, Erdmann J, Reilly MP, Kathiresan S, Schunkert H, Morange PE, Ferrucci L, Eriksson JG, Jacobs D, Deary IJ, Soranzo N, Witteman JC, de Geus EJ, Tracy RP, Hayward C, Koenig W, Cucca F, Jukema JW, Eriksson P, Seshadri S, Markus HS, Watkins H, Samani NJ, Wallaschofski H, Smith NL, Tregouet D, Ridker PM, Tang W, Strachan DP, Hamsten A and O'Donnell CJ.
Journal Circulation 128 (12), 1310-1324 (2013)
Title Single nucleotide polymorphism in CPT1B and CPT2 genes and its association with blood carnitine levels in acute myocardial infarction patients .
Author Khan HA and Alhomida AS.
Journal Gene 523 (1), 76-81 (2013)
Title A common haplotype of carnitine palmitoyltransferase 1b is associated with the metabolic syndrome .
Author Auinger A, Rubin D, Sabandal M, Helwig U, Ruther A, Schreiber S, Foelsch UR, Doring F and Schrezenmeir J.
Journal Br. J. Nutr. 109 (5), 810-815 (2013)
Title Structural and functional genomics of the CPT1B gene for muscle-type carnitine palmitoyltransferase I in mammals .
Author van der Leij FR, Cox KB, Jackson VN, Huijkman NC, Bartelds B, Kuipers JR, Dijkhuizen T, Terpstra P, Wood PA, Zammit VA and Price NT.
Journal J. Biol. Chem. 277 (30), 26994-27005 (2002)
Title Novel expression of equivocal messages containing both regions of choline/ethanolamine kinase and muscle type carnitine palmitoyltransferase I .
Author Yamazaki N, Shinohara Y, Kajimoto K, Shindo M and Terada H.
Journal J. Biol. Chem. 275 (41), 31739-31746 (2000)
Title Co-regulation of tissue-specific alternative human carnitine palmitoyltransferase Ibeta gene promoters by fatty acid enzyme substrate .
Author Yu GS, Lu YC and Gulick T.
Journal J. Biol. Chem. 273 (49), 32901-32909 (1998)
Title Structural features of the gene encoding human muscle type carnitine palmitoyltransferase I .
Author Yamazaki N, Yamanaka Y, Hashimoto Y, Shinohara Y, Shima A and Terada H.
Journal FEBS Lett. 409 (3), 401-406 (1997)
Title Localization and intron usage analysis of the human CPT1B gene for muscle type carnitine palmitoyltransferase I .
Author van der Leij FR, Takens J, van der Veen AY, Terpstra P and Kuipers JR.
Journal Biochim. Biophys. Acta 1352 (2), 123-128 (1997)
Title Fine chromosome mapping of the genes for human liver and muscle carnitine palmitoyltransferase I (CPT1A and CPT1B) .
Author Britton CH, Mackey DW, Esser V, Foster DW, Burns DK, Yarnall DP, Froguel P and McGarry JD.
Journal Genomics 40 (1), 209-211 (1997)
Title Isolation and characterization of cDNA and genomic clones encoding human muscle type carnitine palmitoyltransferase I .
Author Yamazaki N, Shinohara Y, Shima A, Yamanaka Y and Terada H.
Journal Biochim. Biophys. Acta 1307 (2), 157-161 (1996)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.