• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ATP/GTP binding protein-like 1 (AGBL1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu24994 Homo sapiens ATP/GTP binding protein-like 1 (AGBL1), mRNA. pcDNA3.1+-DYK On-demand $1699.00 25
OHu24994C Homo sapiens ATP/GTP binding protein-like 1 (AGBL1), mRNA. Customized vector On-demand $1699.00 25

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_152336.2, 120444923
Length 3201 bp
Structure linear
Update Date 17-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens ATP/GTP binding protein-like 1 (AGBL1), mRNA.
Product cytosolic carboxypeptidase 4
Comment

Summary: Polyglutamylation is a reversible posttranslational modification catalyzed by polyglutamylases that results in the addition of glutamate side chains on the modified protein. This gene encodes a glutamate decarboxylase that catalyzes the deglutamylation of polyglutamylated proteins. Mutations in this gene result in dominant late-onset Fuchs corneal dystrophy. [provided by RefSeq, Nov 2013].


##Evidence-Data-START## RNAseq introns :: mixed/partial sample support ERS025083, ERS025084 [ECO:0000350] ##Evidence-Data-END##

RefSeq NP_689549.2
CDS 81..3281
Misc Feature(1)2169..3062
Misc Feature(2)2169..3062
Misc Feature(3)order(2352..2354,2361..2363,2502..2504,2529..2534,
Misc Feature(4)order(2352..2354,2361..2363,2643..2645)
Exon (1)1..57
Gene:AGBL1
Gene Synonym:CCP4; FECD8
Exon (2)58..204
Gene:AGBL1
Gene Synonym:CCP4; FECD8
Exon (3)205..336
Gene:AGBL1
Gene Synonym:CCP4; FECD8
Exon (4)337..430
Gene:AGBL1
Gene Synonym:CCP4; FECD8
Exon (5)431..468
Gene:AGBL1
Gene Synonym:CCP4; FECD8
Exon (6)469..677
Gene:AGBL1
Gene Synonym:CCP4; FECD8
Exon (7)678..843
Gene:AGBL1
Gene Synonym:CCP4; FECD8
Exon (8)844..911
Gene:AGBL1
Gene Synonym:CCP4; FECD8
Exon (9)912..1028
Gene:AGBL1
Gene Synonym:CCP4; FECD8
Exon (10)1029..1609
Gene:AGBL1
Gene Synonym:CCP4; FECD8
Exon (11)1610..1693
Gene:AGBL1
Gene Synonym:CCP4; FECD8
Exon (12)1694..1780
Gene:AGBL1
Gene Synonym:CCP4; FECD8
Exon (13)1781..1929
Gene:AGBL1
Gene Synonym:CCP4; FECD8
Exon (14)1930..2017
Gene:AGBL1
Gene Synonym:CCP4; FECD8
Exon (15)2018..2162
Gene:AGBL1
Gene Synonym:CCP4; FECD8
Exon (16)2163..2316
Gene:AGBL1
Gene Synonym:CCP4; FECD8
Exon (17)2317..2497
Gene:AGBL1
Gene Synonym:CCP4; FECD8
Exon (18)2498..2627
Gene:AGBL1
Gene Synonym:CCP4; FECD8
Exon (19)2628..2759
Gene:AGBL1
Gene Synonym:CCP4; FECD8
Exon (20)2760..2936
Gene:AGBL1
Gene Synonym:CCP4; FECD8
Exon (21)2937..2999
Gene:AGBL1
Gene Synonym:CCP4; FECD8
Exon (22)3000..3163
Gene:AGBL1
Gene Synonym:CCP4; FECD8
Exon (23)3164..3265
Gene:AGBL1
Gene Synonym:CCP4; FECD8
Exon (24)3266..3493
Gene:AGBL1
Gene Synonym:CCP4; FECD8
Translation MISKGGSEALLQTLVDTARTAPPDYDILLPLFRLLAKVGLRDKKIGRKALELEALDVTLI LARKNLSHGQNLLHCLWALRVFASSVSMGAMLGINGAMELLFKVITPYTRKRTQAIRAAT EVLAALLKSKSNGRRAVNRGYVTSLLGLHQDWHSHDTANAYVQIRRGLLLCLRHIAALRS GREAFLAAQGMEILFSTTQNCLDDKSMEPVISVVLQILRQCYPTSPLPLVTASSAYAFPV PGCITTEPPHDLPEEDFEDDGDDEVDKDSDTEDGKVEDDDLETDVNKLSSKPGLDRPEEE LMQYEVMCLELSYSFEELQSKLGDDLNSEKTQYANHHHIPAAASSKQHCYSKDQSSCGQE REYAVQTSLLCRVKTGRSTVHLGSKKNPGVNLYQNVQSNSLRRDSSESEIPDIQASPKAD AWDVDAIFCPRMSASFSNSTRTREVVKVIDKLLQTHLKRVPFHDPYLYMAKARRTSSVVD FKMMAFPDVWGHCPPPTTQPMLERKCGVQRIRIFEDIRRLIQPSDVINKVVFSLDEPWPL QDNASNCLRFFSKFESGNLRKAIQVREFEYDLLVNADVNSTQHQQWFYFKVSGMQAAIPY HFNIINCEKPNSQFNYGMQPTLYSVKEALLGKPTWIRTGHEICYYKNHYRQSTAVAGGAS GKCYYTLTFAVTFPHSEDVCYLAYHYPYTYTALMTHLDILEKSVNLKEVYFRQDVLCQTL GGNPCPLVTITAMPESNSDEHLEQFRHRPYQVITARVHPGESNASWVMKGTLEFLVSSDP VARLLRENFIFKIIPMLNPDGVINGNHRCSLSGEDLNRQWLSPSAHLQPTIYHAKGLLYH LSSIGRSPVVFCDFHGHSQKKNVFLYGCSIKETLWQAACTVGTSTILEEVNYRTLPKILD KLAPAFTMSSCSFLVEKSRASTARVVVWREMGVSRSYTMESSYCGCNQGPYQCTQRLLER TKNERAHPVDGLQGLQFGTRELEEMGAMFCLGLLILELKSASCSHQLLAQAATLLSAEED ALDQHLQRLKSSNFLPKHIWFAYHFFAITNFFKMNLLLHVSPVCDT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
8+dbSNP:
8+a, gdbSNP:370092102
66+dbSNP:
66+c, tdbSNP:374608767
108+c, tdbSNP:368998211
116+a, gdbSNP:60485756
122+c, gdbSNP:372254095
133+c, tdbSNP:183588077
139+c, tdbSNP:61995730
173+c, gdbSNP:138356654
177+c, tdbSNP:186767486
178+a, gdbSNP:80332650
219+dbSNP:
219+c, tdbSNP:150261781
242+a, gdbSNP:191931920
299+c, tdbSNP:374388706
306+c, gdbSNP:368287289
complement(317)-g, adbSNP:138966010
319+a, gdbSNP:182802715
333+a, gdbSNP:372376267
348+dbSNP:
348+a, gdbSNP:369256384
375+a, gdbSNP:145790658
408+c, tdbSNP:201712819
409+a, gdbSNP:369571083
414+c, tdbSNP:79814209
436+dbSNP:
436+c, gdbSNP:375655107
476+dbSNP:
476+c, tdbSNP:370819428
480+c, tdbSNP:375019409
485+a, gdbSNP:368739645
493..494+, cdbSNP:374540968
503+a, cdbSNP:371409529
518+c, tdbSNP:367631168
557+c, tdbSNP:79994825
564+a, gdbSNP:149477284
573+c, tdbSNP:199894757
584+a, gdbSNP:118017466
600+c, tdbSNP:372060979
603+a, tdbSNP:376348336
607+a, cdbSNP:369996809
609+a, gdbSNP:373842435
615+c, tdbSNP:374832275
647+c, gdbSNP:200880342
650+c, tdbSNP:367899218
676+a, tdbSNP:201507492
687+dbSNP:
687+a, gdbSNP:368107286
697+a, gdbSNP:372045551
707+c, tdbSNP:375624311
708+a, gdbSNP:141984932
710+c, gdbSNP:183456981
728+a, gdbSNP:4496106
731+c, tdbSNP:372417529
complement(732)-t, gdbSNP:1948571
748+c, tdbSNP:185896474
749+c, tdbSNP:369685746
751+c, tdbSNP:369807683
759+c, gdbSNP:200765292
769+c, tdbSNP:199638717
785+a, cdbSNP:150851131
796+c, tdbSNP:199544767
803+a, gdbSNP:386504532
complement(803)-g, adbSNP:1353578
806+a, gdbSNP:190666485
complement(810)-t, cdbSNP:1390866
864+dbSNP:
864+a, gdbSNP:371923647
887+c, tdbSNP:374213102
910+a, gdbSNP:192090714
932+dbSNP:
932+a, gdbSNP:386429906
complement(932)-g, adbSNP:1566088
964+a, tdbSNP:35771845
966+c, tdbSNP:200285527
985+c, tdbSNP:200028178
995+a, gdbSNP:371826143
998+g, tdbSNP:143754366
1039+dbSNP:
1039+c, gdbSNP:201103821
1044+c, gdbSNP:201130765
1063+c, gdbSNP:190791747
1064+c, tdbSNP:79927230
1076+a, gdbSNP:375590503
1082+c, tdbSNP:10520617
1088+c, tdbSNP:376302178
1103+c, tdbSNP:371374511
1104+a, gdbSNP:370030898
1174+c, tdbSNP:372444093
1204+c, tdbSNP:370356818
1205+a, gdbSNP:374390985
1256+a, gdbSNP:368288468
1262+a, cdbSNP:202246257
1263+a, tdbSNP:375498700
1276+a, gdbSNP:371810143
1284+a, gdbSNP:200161522
1292+g, tdbSNP:374845151
1294+a, cdbSNP:79186009
1301+a, gdbSNP:10520618
1303+c, gdbSNP:377154652
1316+c, tdbSNP:369544801
1322+a, gdbSNP:374001216
1330+c, tdbSNP:8029810
1355+g, tdbSNP:369799818
1370+a, cdbSNP:78658366
1383+c, tdbSNP:11857527
1415+c, tdbSNP:372839440
1418+c, tdbSNP:139189895
1424+a, cdbSNP:11856833
1454+g, tdbSNP:373269237
1456+a, gdbSNP:200425510
1466+c, gdbSNP:199539728
1470+a, gdbSNP:201541206
1510+c, gdbSNP:184053635
1523+a, cdbSNP:367677892
1525+a, gdbSNP:372186294
1533+g, tdbSNP:200845665
1553+a, tdbSNP:188199996
1558+c, gdbSNP:201827530
1583+g, tdbSNP:143113232
1637+dbSNP:
1637+c, gdbSNP:267604360
1640+a, cdbSNP:149254832
1721+dbSNP:
1721+c, tdbSNP:375981386
1725+c, tdbSNP:369016709
1726+a, gdbSNP:373676885
1743+c, gdbSNP:371640406
1749+c, gdbSNP:374553036
1750+a, gdbSNP:368424740
1760+c, gdbSNP:374732197
1764+a, gdbSNP:368031166
1777+a, gdbSNP:371664737
1781+dbSNP:
1781+a, gdbSNP:372584442
1784+c, tdbSNP:374673817
1791+a, gdbSNP:199769049
1806+a, gdbSNP:372859846
1810+a, gdbSNP:377400225
1843+a, gdbSNP:369623069
1856+c, tdbSNP:373491857
1857+a, g, tdbSNP:180793760
1858+c, gdbSNP:375036488
1860+a, gdbSNP:200404641
1867+c, tdbSNP:377383541
1908+a, cdbSNP:111352592
complement(1912)-c, adbSNP:79657031
1932+dbSNP:
1932+a, tdbSNP:374208403
1935+c, tdbSNP:368686843
1946+a, gdbSNP:11858435
1957+a, gdbSNP:374836122
1965+c, gdbSNP:147544569
1992+a, gdbSNP:368971095
2007+c, tdbSNP:371674174
complement(2028)-dbSNP:
complement(2028)-t, cdbSNP:148822619
2029+a, gdbSNP:376573682
2052+a, gdbSNP:370629792
2074+a, gdbSNP:117184817
2090+g, tdbSNP:374552195
2093+c, tdbSNP:373963806
2109+a, gdbSNP:371462997
2159+c, tdbSNP:188499359
2174+dbSNP:
2174+c, tdbSNP:9630451
2196+c, tdbSNP:186551539
2201..2202+, adbSNP:34246620
2206+c, tdbSNP:190282686
2251+a, c, tdbSNP:370819074
2252+a, gdbSNP:370011208
2259+c, tdbSNP:372659390
2272+c, tdbSNP:376945285
2311+a, gdbSNP:200042668
2323+dbSNP:
2323+a, gdbSNP:377248005
2327+a, gdbSNP:61998175
2334+g, tdbSNP:370465669
2342+c, tdbSNP:4362360
2364+a, gdbSNP:199888818
2365+c, gdbSNP:140873349
2377+g, tdbSNP:202058432
2393+a, gdbSNP:1367647
2393+a, gdbSNP:386529532
2399+g, tdbSNP:200431794
2403+c, tdbSNP:200957192
2429+g, tdbSNP:200868686
2461+g, tdbSNP:76798821
2466+a, gdbSNP:368965912
2483+c, tdbSNP:143522733
2484+a, gdbSNP:183860717
2493+a, gdbSNP:370339681
2516+dbSNP:
2516+c, tdbSNP:201217861
2517+a, gdbSNP:372004187
2551+a, c, gdbSNP:201523870
2616+c, tdbSNP:371874943
2625+a, gdbSNP:144777747
2630+dbSNP:
2630+g, tdbSNP:369308428
2665+a, tdbSNP:373338498
2676+c, tdbSNP:370119184
2690+a, cdbSNP:376826765
2692+a, gdbSNP:369817008
2699+a, cdbSNP:373021524
2702+a, gdbSNP:61744083
2702+a, gdbSNP:386449377
2845+dbSNP:
2845+c, tdbSNP:374182506
2846+a, gdbSNP:372153251
2868+c, gdbSNP:147523021
2921+c, tdbSNP:368906106
2952+dbSNP:
2952+g, tdbSNP:79173482
2964+a, gdbSNP:8027697
2979+c, tdbSNP:370398595
2991+a, gdbSNP:73459659
3025+dbSNP:
3025+c, tdbSNP:368320952
3036+a, gdbSNP:372345011
3049+c, gdbSNP:181958589
3059+c, tdbSNP:150666065
3069+a, gdbSNP:371869368
3088+c, gdbSNP:368121011
3101+c, tdbSNP:371637847
3109+a, gdbSNP:8028043
3130+c, gdbSNP:199556679
3135+g, tdbSNP:373985407
3140+c, tdbSNP:377271003
3141+a, gdbSNP:369790993
3145+c, tdbSNP:373162753
3162+c, tdbSNP:185919705
3190+dbSNP:
3190+a, gdbSNP:368890317
3191+c, gdbSNP:371055900
3212+c, gdbSNP:201822115
complement(3227)-t, gdbSNP:1006030
3229+a, gdbSNP:114992033
3241+c, tdbSNP:376031682
3256+a, gdbSNP:186628923
3272+dbSNP:
3272+c, tdbSNP:372382444
3303..3304+, aagtdbSNP:376188842
3312+a, cdbSNP:376036658
3317+a, tdbSNP:370353993
3319+g, tdbSNP:373241410
3334+a, cdbSNP:376698148
3419+c, tdbSNP:116954466
3444+a, tdbSNP:371645959
Gene SymbolAGBL1
Gene SynonymCCP4; FECD8
Chromosome15
Locus Map15q25.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_152336 Homo sapiens ATP/GTP binding protein-like 1 (AGBL1), mRNA. On-demand $1699.00 25
Title Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans .
Author Del-Aguila JL, Beitelshees AL, Cooper-Dehoff RM, Chapman AB, Gums JG, Bailey K, Gong Y, Turner ST, Johnson JA and Boerwinkle E.
Journal Pharmacogenomics J. 14 (1), 35-40 (2014)
Title Genome-wide contribution of genotype by environment interaction to variation of diabetes-related traits .
Author Zheng JS, Arnett DK, Lee YC, Shen J, Parnell LD, Smith CE, Richardson K, Li D, Borecki IB, Ordovas JM and Lai CQ.
Journal PLoS ONE 8 (10), E77442 (2013)
Title Mutations in AGBL1 cause dominant late-onset Fuchs corneal dystrophy and alter protein-protein interaction with TCF4 .
Author Riazuddin SA, Vasanth S, Katsanis N and Gottsch JD.
Journal Am. J. Hum. Genet. 93 (4), 758-764 (2013)
Title Evidence for shared genetic risk between methamphetamine-induced psychosis and schizophrenia .
Author Ikeda M, Okahisa Y, Aleksic B, Won M, Kondo N, Naruse N, Aoyama-Uehara K, Sora I, Iyo M, Hashimoto R, Kawamura Y, Nishida N, Miyagawa T, Takeda M, Sasaki T, Tokunaga K, Ozaki N, Ujike H and Iwata N.
Journal Neuropsychopharmacology 38 (10), 1864-1870 (2013)
Title Genetics of coronary artery calcification among African Americans, a meta-analysis .
Author Wojczynski MK, Li M, Bielak LF, Kerr KF, Reiner AP, Wong ND, Yanek LR, Qu L, White CC, Lange LA, Ferguson JF, He J, Young T, Mosley TH, Smith JA, Kral BG, Guo X, Wong Q, Ganesh SK, Heckbert SR, Griswold ME, O'Leary DH, Budoff M, Carr JJ, Taylor HA Jr, Bluemke DA, Demissie S, Hwang SJ, Paltoo DN, Polak JF, Psaty BM, Becker DM, Province MA, Post WS, O'Donnell CJ, Wilson JG, Harris TB, Kavousi M, Cupples LA, Rotter JI, Fornage M, Becker LC, Peyser PA, Borecki
Journal BMC Med. Genet. 14, 75 (2013)
Title Common variants at the MHC locus and at chromosome 16q24.1 predispose to Barrett's esophagus .
Author Su Z, Gay LJ, Strange A, Palles C, Band G, Whiteman DC, Lescai F, Langford C, Nanji M, Edkins S, van der Winkel A, Levine D, Sasieni P, Bellenguez C, Howarth K, Freeman C, Trudgill N, Tucker AT, Pirinen M, Peppelenbosch MP, van der Laan LJ, Kuipers EJ, Drenth JP, Peters WH, Reynolds JV, Kelleher DP, McManus R, Grabsch H, Prenen H, Bisschops R, Krishnadath K, Siersema PD, van Baal JW, Middleton M, Petty R, Gillies R, Burch N, Bhandari P, Paterson S, Edwards C, Penman I, Vaidya K, Ang Y, Murray I, Patel P, Ye W, Mullins P, Wu AH, Bird NC, Dallal H, Shaheen NJ, Murray LJ, Koss K, Bernstein L, Romero Y, Hardie LJ, Zhang R, Winter H, Corley DA, Panter S, Risch HA, Reid BJ, Sargeant I, Gammon MD, Smart H, Dhar A, McMurtry H, Ali H, Liu G, Casson AG, Chow WH, Rutter M, Tawil A, Morris D, Nwokolo C, Isaacs P, Rodgers C, Ragunath K, MacDonald C, Haigh C, Monk D, Davies G, Wajed S, Johnston D, Gibbons M, Cullen S, Church N, Langley R, Griffin M, Alderson D, Deloukas P, Hunt SE, Gray E, Dronov S, Potter SC, Tashakkori-Ghanbaria A, Anderson M, Brooks C, Blackwell JM, Bramon E, Brown MA, Casas JP, Corvin A, Duncanson A, Markus HS, Mathew CG, Palmer CN, Plomin R, Rautanen A, Sawcer SJ, Trembath RC, Viswanathan AC, Wood N, Trynka G, Wijmenga C, Cazier JB, Atherfold P, Nicholson AM, Gellatly NL, Glancy D, Cooper SC, Cunningham D, Lind T, Hapeshi J, Ferry D, Rathbone B, Brown J, Love S, Attwood S, MacGregor S, Watson P, Sanders S, Ek W, Harrison RF, Moayyedi P, de Caestecker J, Barr H, Stupka E, Vaughan TL, Peltonen L, Spencer CC, Tomlinson I, Donnelly P and Jankowski JA.
Journal Nat. Genet. 44 (10), 1131-1136 (2012)
Title Genetic associations for activated partial thromboplastin time and prothrombin time, their gene expression profiles, and risk of coronary artery disease .
Author Tang W, Schwienbacher C, Lopez LM, Ben-Shlomo Y, Oudot-Mellakh T, Johnson AD, Samani NJ, Basu S, Gogele M, Davies G, Lowe GD, Tregouet DA, Tan A, Pankow JS, Tenesa A, Levy D, Volpato CB, Rumley A, Gow AJ, Minelli C, Yarnell JW, Porteous DJ, Starr JM, Gallacher J, Boerwinkle E, Visscher PM, Pramstaller PP, Cushman M, Emilsson V, Plump AS, Matijevic N, Morange PE, Deary IJ, Hicks AA and Folsom AR.
Journal Am. J. Hum. Genet. 91 (1), 152-162 (2012)
Title Pharmacogenomic study of side-effects for antidepressant treatment options in STAR*D .
Author Clark SL, Adkins DE, Aberg K, Hettema JM, McClay JL, Souza RP and van den Oord EJ.
Journal Psychol Med 42 (6), 1151-1162 (2012)
Title Genome-wide association study does not reveal major genetic determinants for anti-cytomegalovirus antibody response .
Author Kuparinen T, Seppala I, Jylhava J, Marttila S, Aittoniemi J, Kettunen J, Viikari J, Kahonen M, Raitakari O, Lehtimaki T and Hurme M.
Journal Genes Immun. 13 (2), 184-190 (2012)
Title Meta-analysis of genome-wide association for migraine in six population-based European cohorts .
Author Ligthart L, de Vries B, Smith AV, Ikram MA, Amin N, Hottenga JJ, Koelewijn SC, Kattenberg VM, de Moor MH, Janssens AC, Aulchenko YS, Oostra BA, de Geus EJ, Smit JH, Zitman FG, Uitterlinden AG, Hofman A, Willemsen G, Nyholt DR, Montgomery GW, Terwindt GM, Gudnason V, Penninx BW, Breteler M, Ferrari MD, Launer LJ, van Duijn CM, van den Maagdenberg AM and Boomsma DI.
Journal Eur. J. Hum. Genet. 19 (8), 901-907 (2011)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.