• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ATP/GTP binding protein-like 1 (AGBL1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_152336 Homo sapiens ATP/GTP binding protein-like 1 (AGBL1), mRNA. GenEZ ORF Cloning On-demand $1699.00 25

*Business Day

Related Services

RefSeq Version NM_152336.2, 120444923
Length 3493 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens ATP/GTP binding protein-like 1 (AGBL1), mRNA.
Product cytosolic carboxypeptidase 4
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DV080218.1, DV080541.1, DV080486.1, AC025842.11, DY655391.1, AK056872.1, BC128152.1, DY655510.1, DV080155.1, AC022817.8, DA695799.1, AC012229.8 and AC016987.4. On Dec 30, 2006 this sequence version replaced gi:22748732.


##Evidence-Data-START## RNAseq introns :: mixed/partial sample support ERS025084, ERS025085 [ECO:0000350] ##Evidence-Data-END##

RefSeq NP_689549.2
CDS 81..3281
Misc Feature(1)2169..3062
Misc Feature(2)2169..3062
Misc Feature(3)order(2352..2354,2361..2363,2502..2504,2529..2534,
Misc Feature(4)order(2352..2354,2361..2363,2643..2645)
Exon (1)1..57
Gene:AGBL1
Gene Synonym:AGBL1
Exon (2)58..204
Gene:AGBL1
Gene Synonym:AGBL1
Exon (3)205..336
Gene:AGBL1
Gene Synonym:AGBL1
Exon (4)337..430
Gene:AGBL1
Gene Synonym:AGBL1
Exon (5)431..468
Gene:AGBL1
Gene Synonym:AGBL1
Exon (6)469..677
Gene:AGBL1
Gene Synonym:AGBL1
Exon (7)678..843
Gene:AGBL1
Gene Synonym:AGBL1
Exon (8)844..911
Gene:AGBL1
Gene Synonym:AGBL1
Exon (9)912..1028
Gene:AGBL1
Gene Synonym:AGBL1
Exon (10)1029..1609
Gene:AGBL1
Gene Synonym:AGBL1
Exon (11)1610..1693
Gene:AGBL1
Gene Synonym:AGBL1
Exon (12)1694..1780
Gene:AGBL1
Gene Synonym:AGBL1
Exon (13)1781..1929
Gene:AGBL1
Gene Synonym:AGBL1
Exon (14)1930..2017
Gene:AGBL1
Gene Synonym:AGBL1
Exon (15)2018..2162
Gene:AGBL1
Gene Synonym:AGBL1
Exon (16)2163..2316
Gene:AGBL1
Gene Synonym:AGBL1
Exon (17)2317..2497
Gene:AGBL1
Gene Synonym:AGBL1
Exon (18)2498..2627
Gene:AGBL1
Gene Synonym:AGBL1
Exon (19)2628..2759
Gene:AGBL1
Gene Synonym:AGBL1
Exon (20)2760..2936
Gene:AGBL1
Gene Synonym:AGBL1
Exon (21)2937..2999
Gene:AGBL1
Gene Synonym:AGBL1
Exon (22)3000..3163
Gene:AGBL1
Gene Synonym:AGBL1
Exon (23)3164..3265
Gene:AGBL1
Gene Synonym:AGBL1
Exon (24)3266..3493
Gene:AGBL1
Gene Synonym:AGBL1
Translation MISKGGSEALLQTLVDTARTAPPDYDILLPLFRLLAKVGLRDKKIGRKALELEALDVTLI LARKNLSHGQNLLHCLWALRVFASSVSMGAMLGINGAMELLFKVITPYTRKRTQAIRAAT EVLAALLKSKSNGRRAVNRGYVTSLLGLHQDWHSHDTANAYVQIRRGLLLCLRHIAALRS GREAFLAAQGMEILFSTTQNCLDDKSMEPVISVVLQILRQCYPTSPLPLVTASSAYAFPV PGCITTEPPHDLPEEDFEDDGDDEVDKDSDTEDGKVEDDDLETDVNKLSSKPGLDRPEEE LMQYEVMCLELSYSFEELQSKLGDDLNSEKTQYANHHHIPAAASSKQHCYSKDQSSCGQE REYAVQTSLLCRVKTGRSTVHLGSKKNPGVNLYQNVQSNSLRRDSSESEIPDIQASPKAD AWDVDAIFCPRMSASFSNSTRTREVVKVIDKLLQTHLKRVPFHDPYLYMAKARRTSSVVD FKMMAFPDVWGHCPPPTTQPMLERKCGVQRIRIFEDIRRLIQPSDVINKVVFSLDEPWPL QDNASNCLRFFSKFESGNLRKAIQVREFEYDLLVNADVNSTQHQQWFYFKVSGMQAAIPY HFNIINCEKPNSQFNYGMQPTLYSVKEALLGKPTWIRTGHEICYYKNHYRQSTAVAGGAS GKCYYTLTFAVTFPHSEDVCYLAYHYPYTYTALMTHLDILEKSVNLKEVYFRQDVLCQTL GGNPCPLVTITAMPESNSDEHLEQFRHRPYQVITARVHPGESNASWVMKGTLEFLVSSDP VARLLRENFIFKIIPMLNPDGVINGNHRCSLSGEDLNRQWLSPSAHLQPTIYHAKGLLYH LSSIGRSPVVFCDFHGHSQKKNVFLYGCSIKETLWQAACTVGTSTILEEVNYRTLPKILD KLAPAFTMSSCSFLVEKSRASTARVVVWREMGVSRSYTMESSYCGCNQGPYQCTQRLLER TKNERAHPVDGLQGLQFGTRELEEMGAMFCLGLLILELKSASCSHQLLAQAATLLSAEED ALDQHLQRLKSSNFLPKHIWFAYHFFAITNFFKMNLLLHVSPVCDT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
116+a, gdbSNP:60485756
133+c, tdbSNP:183588077
139+c, tdbSNP:61995730
173+c, gdbSNP:138356654
177+c, tdbSNP:186767486
178+a, gdbSNP:80332650
219+dbSNP:
219+c, tdbSNP:150261781
242+a, gdbSNP:191931920
317+a, gdbSNP:138966010
319+a, gdbSNP:182802715
375+dbSNP:
375+a, gdbSNP:145790658
408+c, tdbSNP:201712819
414+c, tdbSNP:79814209
557+dbSNP:
557+c, tdbSNP:79994825
564+a, gdbSNP:149477284
573+c, tdbSNP:199894757
584+a, gdbSNP:118017466
647+c, gdbSNP:200880342
676+a, tdbSNP:201507492
708+dbSNP:
708+a, gdbSNP:141984932
710+c, gdbSNP:183456981
728+a, gdbSNP:4496106
732+g, tdbSNP:1948571
748+c, tdbSNP:185896474
759+c, gdbSNP:200765292
769+c, tdbSNP:199638717
785+a, cdbSNP:150851131
796+c, tdbSNP:199544767
803+a, gdbSNP:1353578
806+a, gdbSNP:190666485
810+c, tdbSNP:1390866
910+dbSNP:
910+a, gdbSNP:192090714
932+dbSNP:
932+a, gdbSNP:1566088
964+a, tdbSNP:35771845
966+c, tdbSNP:200285527
985+c, tdbSNP:200028178
998+g, tdbSNP:143754366
1039+dbSNP:
1039+c, gdbSNP:201103821
1044+c, gdbSNP:201130765
1063+c, gdbSNP:190791747
1064+c, tdbSNP:79927230
1082+c, tdbSNP:10520617
1262+a, cdbSNP:202246257
1284+a, gdbSNP:200161522
1294+a, cdbSNP:79186009
1301+a, gdbSNP:10520618
1330+c, tdbSNP:8029810
1370+a, cdbSNP:78658366
1383+c, tdbSNP:11857527
1418+c, tdbSNP:139189895
1424+a, cdbSNP:11856833
1456+a, gdbSNP:200425510
1466+c, gdbSNP:199539728
1470+a, gdbSNP:201541206
1510+c, gdbSNP:184053635
1533+g, tdbSNP:200845665
1553+a, tdbSNP:188199996
1558+c, gdbSNP:201827530
1583+g, tdbSNP:143113232
1640+dbSNP:
1640+a, cdbSNP:149254832
1791+dbSNP:
1791+a, gdbSNP:199769049
1857+a, gdbSNP:180793760
1860+a, gdbSNP:200404641
1908+a, cdbSNP:111352592
1912+a, cdbSNP:79657031
1946+dbSNP:
1946+a, gdbSNP:11858435
1965+c, gdbSNP:147544569
2028+dbSNP:
2028+c, tdbSNP:148822619
2074+a, gdbSNP:117184817
2159+c, tdbSNP:188499359
2174+dbSNP:
2174+c, tdbSNP:9630451
2196+c, tdbSNP:186551539
2199..2200+, adbSNP:34246620
2206+c, tdbSNP:190282686
2311+a, gdbSNP:200042668
2327+dbSNP:
2327+a, gdbSNP:61998175
2342+c, tdbSNP:4362360
2364+a, gdbSNP:199888818
2365+c, gdbSNP:140873349
2377+g, tdbSNP:202058432
2393+a, gdbSNP:1367647
2399+g, tdbSNP:200431794
2403+c, tdbSNP:200957192
2429+g, tdbSNP:200868686
2461+g, tdbSNP:76798821
2483+c, tdbSNP:143522733
2484+a, gdbSNP:183860717
2516+dbSNP:
2516+c, tdbSNP:201217861
2551+a, c, gdbSNP:201523870
2625+a, gdbSNP:144777747
2702+dbSNP:
2702+a, gdbSNP:61744083
2868+dbSNP:
2868+c, gdbSNP:147523021
2952+dbSNP:
2952+g, tdbSNP:79173482
2964+a, gdbSNP:8027697
2991+a, gdbSNP:73459659
3049+dbSNP:
3049+c, gdbSNP:181958589
3059+c, tdbSNP:150666065
3109+a, gdbSNP:8028043
3130+c, gdbSNP:199556679
3162+c, tdbSNP:185919705
3212+dbSNP:
3212+c, gdbSNP:201822115
3227+g, tdbSNP:1006030
3229+a, gdbSNP:114992033
3256+a, gdbSNP:186628923
3419+dbSNP:
3419+c, tdbSNP:116954466
Gene SymbolAGBL1
Gene SynonymAGBL1
Chromosome15
Locus Map15q25.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_152336 Homo sapiens ATP/GTP binding protein-like 1 (AGBL1), mRNA. On-demand $1699.00 25
Title Genetic associations for activated partial thromboplastin time and prothrombin time, their gene expression profiles, and risk of coronary artery disease .
Author Tang,W., Schwienbacher,C., Lopez,L.M., Ben-Shlomo,Y., Oudot-Mellakh,T., Johnson,A.D., Samani,N.J., Basu,S., Gogele,M., Davies,G., Lowe,G.D., Tregouet,D.A., Tan,A., Pankow,J.S., Tenesa,A., Levy,D., Volpato,C.B., Rumley,A., Gow,A.J., Minelli,C., Yarnell,J.W., Porteous,D.J., Starr,J.M., Gallacher,J., Boerwinkle,E., Visscher,P.M., Pramstaller,P.P., Cushman,M., Emilsson,V., Plump,A.S., Matijevic,N., Morange,P.E., Deary,I.J., Hicks,A.A. and Folsom,A.R.
Journal Am. J. Hum. Genet. 91 (1), 152-162 (2012)
Title Pharmacogenomic study of side-effects for antidepressant treatment options in STAR*D .
Author Clark,S.L., Adkins,D.E., Aberg,K., Hettema,J.M., McClay,J.L., Souza,R.P. and van den Oord,E.J.
Journal Psychol Med 42 (6), 1151-1162 (2012)
Title Genome-wide association study does not reveal major genetic determinants for anti-cytomegalovirus antibody response .
Author Kuparinen,T., Seppala,I., Jylhava,J., Marttila,S., Aittoniemi,J., Kettunen,J., Viikari,J., Kahonen,M., Raitakari,O., Lehtimaki,T. and Hurme,M.
Journal Genes Immun. 13 (2), 184-190 (2012)
Title Meta-analysis of genome-wide association for migraine in six population-based European cohorts .
Author Ligthart,L., de Vries,B., Smith,A.V., Ikram,M.A., Amin,N., Hottenga,J.J., Koelewijn,S.C., Kattenberg,V.M., de Moor,M.H., Janssens,A.C., Aulchenko,Y.S., Oostra,B.A., de Geus,E.J., Smit,J.H., Zitman,F.G., Uitterlinden,A.G., Hofman,A., Willemsen,G., Nyholt,D.R., Montgomery,G.W., Terwindt,G.M., Gudnason,V., Penninx,B.W., Breteler,M., Ferrari,M.D., Launer,L.J., van Duijn,C.M., van den Maagdenberg,A.M. and Boomsma,D.I.
Journal Eur. J. Hum. Genet. 19 (8), 901-907 (2011)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.