• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens LSM12 homolog (S. cerevisiae) (LSM12), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu06735 Homo sapiens LSM12 homolog (S. cerevisiae) (LSM12), mRNA. pcDNA3.1+-DYK On-demand $159.00 7-9
OHu06735C Homo sapiens LSM12 homolog (S. cerevisiae) (LSM12), mRNA. Customized vector On-demand $209.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_152344.3, 209977040
Length 588 bp
Structure linear
Update Date 26-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens LSM12 homolog (S. cerevisiae) (LSM12), mRNA.
Product protein LSM12 homolog
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BC066298.1, BC044587.1 and AL832076.1. On Oct 28, 2008 this sequence version replaced gi:141803542.


##Evidence-Data-START## Transcript exon combination :: BC066298.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025087, ERS025093 [ECO:0000350] ##Evidence-Data-END##

RefSeq NP_689557.1
CDS 324..911
Misc Feature(1)105..107
Misc Feature(2)105..107
Misc Feature(3)327..329
Misc Feature(4)327..329
Misc Feature(5)342..524
Misc Feature(6)order(366..386,390..428,435..449)
Misc Feature(7)order(420..422,426..428,498..500)
Misc Feature(8)486..521
Misc Feature(9)546..548
Misc Feature(10)555..818
Exon (1)1..177
Gene:LSM12
Gene Synonym:PNAS-135
Exon (2)178..447
Gene:LSM12
Gene Synonym:PNAS-135
Exon (3)448..581
Gene:LSM12
Gene Synonym:PNAS-135
Exon (4)582..691
Gene:LSM12
Gene Synonym:PNAS-135
Exon (5)692..818
Gene:LSM12
Gene Synonym:PNAS-135
Exon (6)819..2484
Gene:LSM12
Gene Synonym:PNAS-135
Translation MAAPPGEYFSVGSQVSCRTCQEQRLQGEVVAFDYQSKMLALKCPSSSGKPNHADILLINL QYVSEVEIINDRTETPPPLASLNVSKLASKARTEKEEKLSQAYAISAGVSLEGQQLFQTI HKTIKDCKWQEKNIVVMEEVVITPPYQVENCKGKEGSALSHVRKIVEKHFRDVESQKILQ RSQAQQPQKEAALSS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(242)-dbSNP:
complement(242)-g, cdbSNP:9900620
complement(289)-g, adbSNP:200239929
complement(393)-t, gdbSNP:374081346
complement(512)-dbSNP:
complement(512)-g, adbSNP:147935602
complement(540)-t, cdbSNP:371987170
complement(553)-g, cdbSNP:17854322
complement(557)-g, adbSNP:144774734
complement(558)-g, adbSNP:140825054
complement(588..589)-dbSNP:
complement(588..589)-, gdbSNP:35289335
complement(658)-t, cdbSNP:200007996
complement(659)-g, cdbSNP:142436733
complement(662)-g, adbSNP:180785369
complement(692)-dbSNP:
complement(692)-g, adbSNP:199904232
complement(693)-t, cdbSNP:370655571
complement(707)-g, adbSNP:35841935
complement(714)-g, adbSNP:228753
complement(737)-t, cdbSNP:200915259
complement(755)-t, gdbSNP:184059566
complement(809)-t, cdbSNP:373598475
complement(839)-dbSNP:
complement(839)-g, adbSNP:145390048
complement(840)-g, cdbSNP:59168537
complement(862)-t, cdbSNP:368988511
complement(993..994)-, tdbSNP:35468252
complement(1408)-c, adbSNP:190750240
complement(2285)-t, cdbSNP:113242069
complement(2308)-c, adbSNP:11654662
Gene SymbolLSM12
Gene SynonymPNAS-135
Chromosome17
Locus Map17q21.31
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_152344 Homo sapiens LSM12 homolog (S. cerevisiae) (LSM12), mRNA. On-demand $159.00 7-9
Title Novel Sm-like proteins with long C-terminal tails and associated methyltransferases .
Author Albrecht M and Lengauer T.
Journal FEBS Lett. 569 (1-3), 18-26 (2004)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.