• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens sprouty-related, EVH1 domain containing 1 (SPRED1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_152594 Homo sapiens sprouty-related, EVH1 domain containing 1 (SPRED1), mRNA. GenEZ ORF Cloning On-demand $699.00 18

*Business Day

Related Services

RefSeq Version NM_152594.2, 187169267
Length 7255 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens sprouty-related, EVH1 domain containing 1 (SPRED1), mRNA.
Product sprouty-related, EVH1 domain-containing protein 1
Comment

Summary: The protein encoded by this gene is a member of the Sprouty family of proteins and is phosphorylated by tyrosine kinase in response to several growth factors. The encoded protein can act as a homodimer or as a heterodimer with SPRED2 to regulate activation of the MAP kinase cascade. Defects in this gene are a cause of neurofibromatosis type 1-like syndrome (NFLS). [provided by RefSeq, Jul 2008].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments.

RefSeq NP_689807.1
CDS 336..1670
Misc Feature(1)210..212
Misc Feature(2)378..695
Misc Feature(3)378..695
Misc Feature(4)order(378..401,444..455,459..467,507..527,573..587,
Misc Feature(5)1329..1607
Exon (1)1..367
Gene:SPRED1
Gene Synonym:hSpred1; NFLS; spred-1
Exon (2)368..542
Gene:SPRED1
Gene Synonym:hSpred1; NFLS; spred-1
Exon (3)543..711
Gene:SPRED1
Gene Synonym:hSpred1; NFLS; spred-1
Exon (4)712..758
Gene:SPRED1
Gene Synonym:hSpred1; NFLS; spred-1
Exon (5)759..917
Gene:SPRED1
Gene Synonym:hSpred1; NFLS; spred-1
Exon (6)918..1019
Gene:SPRED1
Gene Synonym:hSpred1; NFLS; spred-1
Exon (7)1020..7255
Gene:SPRED1
Gene Synonym:hSpred1; NFLS; spred-1
Translation MSEETATSDNDNSYARVRAVVMTRDDSSGGWLPLGGSGLSSVTVFKVPHQEENGCADFFI RGERLRDKMVVLECMLKKDLIYNKVTPTFHHWKIDDKKFGLTFQSPADARAFDRGIRRAI EDISQGCPESKNEAEGADDLQANEEDSSSSLVKDHLFQQETVVTSEPYRSSNIRPSPFED LNARRVYMQSQANQITFGQPGLDIQSRSMEYVQRQISKECGSLKSQNRVPLKSIRHVSFQ DEDEIVRINPRDILIRRYADYRHPDMWKNDLERDDADSSIQFSKPDSKKSDYLYSCGDET KLSSPKDSVVFKTQPSSLKIKKSKRRKEDGERSRCVYCQERFNHEENVRGKCQDAPDPIK RCIYQVSCMLCAESMLYHCMSDSEGDFSDPCSCDTSDDKFCLRWLALVALSFIVPCMCCY VPLRMCHRCGEACGCCGGKHKAAG
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
4+dbSNP:
4+a, gdbSNP:147075186
92+c, tdbSNP:138385793
243+c, tdbSNP:192699510
361+a, tdbSNP:200157475
365+a, cdbSNP:201692618
405+dbSNP:
405+c, tdbSNP:121434313
459+a, gdbSNP:147204964
466+a, tdbSNP:121434318
483+c, tdbSNP:148646547
525+c, tdbSNP:121434315
626+a, gdbSNP:7182445
684+c, tdbSNP:121434312
723+dbSNP:
723+c, tdbSNP:149883080
752+c, tdbSNP:12148911
870+dbSNP:
870+a, gdbSNP:143121426
896+c, tdbSNP:201335683
899+a, gdbSNP:202092705
900+a, cdbSNP:200142785
922+dbSNP:
922+c, tdbSNP:147474792
942+a, gdbSNP:139897054
968+c, tdbSNP:149991304
972+c, tdbSNP:121434316
978+c, tdbSNP:121434314
980+a, cdbSNP:144227155
1010+c, tdbSNP:144764225
1020+dbSNP:
1020+g, tdbSNP:201837340
1037+c, gdbSNP:138553244
1119+a, tdbSNP:121434317
1130+c, tdbSNP:116667267
1156+a, gdbSNP:111363743
1210+a, gdbSNP:201933663
1222+a, gdbSNP:200974459
1261+c, tdbSNP:114636635
1274+a, gdbSNP:140644874
1279+c, tdbSNP:115440602
1336+a, gdbSNP:146702985
1379+a, gdbSNP:3751526
1424+a, gdbSNP:140225135
1557+g, tdbSNP:150307819
1595+c, tdbSNP:202087411
1630+c, tdbSNP:200871227
1838+c, tdbSNP:192826011
1918+c, tdbSNP:16966842
1926+c, tdbSNP:145373657
1991+a, gdbSNP:137920898
2052+c, gdbSNP:13329392
2097+a, tdbSNP:185290497
2248..2249+, atdbSNP:147547509
2303+a, gdbSNP:118146919
2406+a, tdbSNP:188754645
2506+a, gdbSNP:192636064
2613+g, tdbSNP:183715838
2710+a, gdbSNP:115568221
2728..2729+, adbSNP:34079057
2784+g, tdbSNP:141742028
2862+c, tdbSNP:28536719
2864+c, tdbSNP:28576519
3162+g, tdbSNP:199891616
3327..3330+, ctatdbSNP:146972863
3329..3332+, atctdbSNP:57589132
3329+a, gdbSNP:113071870
3394+a, cdbSNP:1554527
3688+g, tdbSNP:188392935
3713+a, gdbSNP:180946373
3917+a, gdbSNP:118057877
4090+c, tdbSNP:184024152
4240+c, tdbSNP:111997668
4268+a, cdbSNP:189861748
4281+c, tdbSNP:181716461
4292+a, gdbSNP:138645237
4412+g, tdbSNP:149336440
4456+c, gdbSNP:147428585
4501+a, gdbSNP:35490364
4523+a, gdbSNP:187134665
4555+a, gdbSNP:79309779
4727+a, gdbSNP:72725362
4781+c, tdbSNP:111766079
4834+a, gdbSNP:191914374
5065+a, gdbSNP:140749542
5191+a, gdbSNP:11634702
5230+a, gdbSNP:200294834
5231+a, gdbSNP:181980647
5242+a, gdbSNP:113753698
5261+c, tdbSNP:147489619
5293+g, tdbSNP:148525432
5317+g, tdbSNP:186366365
5368+g, tdbSNP:76527876
5415+a, gdbSNP:142928983
5500+a, gdbSNP:8039150
5562+g, tdbSNP:112221665
5616+a, gdbSNP:8039337
5666+a, gdbSNP:72725364
5712+a, cdbSNP:189589145
5771+a, gdbSNP:182237934
6042+a, gdbSNP:187788660
6106+a, gdbSNP:191601293
6156+a, gdbSNP:183379085
6332+a, tdbSNP:10852019
6366+c, tdbSNP:151078068
6367+a, gdbSNP:188784206
6437+c, gdbSNP:141044168
6602+a, gdbSNP:16966843
6607+a, cdbSNP:143932642
6753..6754+, tdbSNP:141174183
6780+c, tdbSNP:8026118
6805+a, cdbSNP:146871244
6933+a, cdbSNP:78521927
7059+a, gdbSNP:192448813
7068+g, tdbSNP:115003524
7079+a, gdbSNP:184793714
7130+a, gdbSNP:187951608
7190+c, tdbSNP:140245434
Gene SymbolSPRED1
Gene SynonymhSpred1; NFLS; spred-1
Chromosome15
Locus Map15q14
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_152594 Homo sapiens sprouty-related, EVH1 domain containing 1 (SPRED1), mRNA. On-demand $699.00 18
Title Review and update of SPRED1 mutations causing Legius syndrome .
Author Brems,H., Pasmant,E., Van Minkelen,R., Wimmer,K., Upadhyaya,M., Legius,E. and Messiaen,L.
Journal Hum. Mutat. 33 (11), 1538-1546 (2012)
Title A shared molecular mechanism underlies the human rasopathies Legius syndrome and Neurofibromatosis-1 .
Author Stowe,I.B., Mercado,E.L., Stowe,T.R., Bell,E.L., Oses-Prieto,J.A., Hernandez,H., Burlingame,A.L. and McCormick,F.
Journal Genes Dev. 26 (13), 1421-1426 (2012)
Title Interaction of the receptor FGFRL1 with the negative regulator Spred1 .
Author Zhuang,L., Villiger,P. and Trueb,B.
Journal Cell. Signal. 23 (9), 1496-1504 (2011)
Title Sprouty-related Ena/vasodilator-stimulated phosphoprotein homology 1-domain-containing protein (SPRED1), a tyrosine-protein phosphatase non-receptor type 11 (SHP2) substrate in the Ras/extracellular signal-regulated kinase (ERK) pathway .
Author Quintanar-Audelo,M., Yusoff,P., Sinniah,S., Chandramouli,S. and Guy,G.R.
Journal J. Biol. Chem. 286 (26), 23102-23112 (2011)
Title Identification of five novel SPRED1 germline mutations in Legius syndrome .
Author Laycock-van Spyk,S., Jim,H.P., Thomas,L., Spurlock,G., Fares,L., Palmer-Smith,S., Kini,U., Saggar,A., Patton,M., Mautner,V., Pilz,D.T. and Upadhyaya,M.
Journal Clin. Genet. 80 (1), 93-96 (2011)
Title Distinct requirements for the Sprouty domain for functional activity of Spred proteins .
Author King,J.A., Straffon,A.F., D'Abaco,G.M., Poon,C.L., I,S.T., Smith,C.M., Buchert,M., Corcoran,N.M., Hall,N.E., Callus,B.A., Sarcevic,B., Martin,D., Lock,P. and Hovens,C.M.
Journal Biochem. J. 388 (PT 2), 445-454 (2005)
Title Spred-1 negatively regulates interleukin-3-mediated ERK/mitogen-activated protein (MAP) kinase activation in hematopoietic cells .
Author Nonami,A., Kato,R., Taniguchi,K., Yoshiga,D., Taketomi,T., Fukuyama,S., Harada,M., Sasaki,A. and Yoshimura,A.
Journal J. Biol. Chem. 279 (50), 52543-52551 (2004)
Title Functional proteomics mapping of a human signaling pathway .
Author Colland,F., Jacq,X., Trouplin,V., Mougin,C., Groizeleau,C., Hamburger,A., Meil,A., Wojcik,J., Legrain,P. and Gauthier,J.M.
Journal Genome Res. 14 (7), 1324-1332 (2004)
Title Molecular cloning of mammalian Spred-3 which suppresses tyrosine kinase-mediated Erk activation .
Author Kato,R., Nonami,A., Taketomi,T., Wakioka,T., Kuroiwa,A., Matsuda,Y. and Yoshimura,A.
Journal Biochem. Biophys. Res. Commun. 302 (4), 767-772 (2003)
Title Spred is a Sprouty-related suppressor of Ras signalling .
Author Wakioka,T., Sasaki,A., Kato,R., Shouda,T., Matsumoto,A., Miyoshi,K., Tsuneoka,M., Komiya,S., Baron,R. and Yoshimura,A.
Journal Nature 412 (6847), 647-651 (2001)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.