• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens BRCA1-associated ATM activator 1 (BRAT1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_152743 Homo sapiens BRCA1-associated ATM activator 1 (BRAT1), mRNA. GenEZ ORF Cloning On-demand $899.00 20

*Business Day

Related Services

RefSeq Version NM_152743.3, 304555613
Length 3013 bp
Structure linear
Update Date 10-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens BRCA1-associated ATM activator 1 (BRAT1), mRNA.
Product BRCA1-associated ATM activator 1
Comment

Summary: The protein encoded by this ubiquitously expressed gene interacts with the tumor suppressing BRCA1 (breast cancer 1) protein and and the ATM (ataxia telangiectasia mutated) protein. ATM is thought to be a master controller of cell cycle checkpoint signalling pathways that are required for cellular responses to DNA damage such as double-strand breaks that are induced by ionizing radiation and complexes with BRCA1 in the multi-protein complex BASC (BRAC1-associated genome surveillance complex). The protein encoded by this gene is thought to play a role in the DNA damage pathway regulated by BRCA1 and ATM. [provided by RefSeq, Mar 2012].


##Evidence-Data-START## Transcript exon combination :: BC015632.2 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_689956.2
CDS 289..2754
Misc Feature(1)16..18
Misc Feature(2)16..18
Misc Feature(3)1771..1881
Misc Feature(4)1771..1881
Misc Feature(5)1918..2016
Misc Feature(6)2512..2514
Exon (1)1..272
Gene:BRAT1
Gene Synonym:BAAT1; C7orf27; RMFSL
Exon (2)273..415
Gene:BRAT1
Gene Synonym:BAAT1; C7orf27; RMFSL
Exon (3)416..570
Gene:BRAT1
Gene Synonym:BAAT1; C7orf27; RMFSL
Exon (4)571..718
Gene:BRAT1
Gene Synonym:BAAT1; C7orf27; RMFSL
Exon (5)719..1091
Gene:BRAT1
Gene Synonym:BAAT1; C7orf27; RMFSL
Exon (6)1092..1211
Gene:BRAT1
Gene Synonym:BAAT1; C7orf27; RMFSL
Exon (7)1212..1303
Gene:BRAT1
Gene Synonym:BAAT1; C7orf27; RMFSL
Exon (8)1304..1422
Gene:BRAT1
Gene Synonym:BAAT1; C7orf27; RMFSL
Exon (9)1423..1609
Gene:BRAT1
Gene Synonym:BAAT1; C7orf27; RMFSL
Exon (10)1610..1683
Gene:BRAT1
Gene Synonym:BAAT1; C7orf27; RMFSL
Exon (11)1684..1786
Gene:BRAT1
Gene Synonym:BAAT1; C7orf27; RMFSL
Exon (12)1787..1885
Gene:BRAT1
Gene Synonym:BAAT1; C7orf27; RMFSL
Exon (13)1886..2058
Gene:BRAT1
Gene Synonym:BAAT1; C7orf27; RMFSL
Exon (14)2059..3013
Gene:BRAT1
Gene Synonym:BAAT1; C7orf27; RMFSL
Translation MDPECAQLLPALCAVLVDPRQPVADDTCLEKLLDWFKTVTEGESSVVLLQEHPCLVELLS HVLKVQDLSSGVLSFSLRLAGTFAAQENCFQYLQQGELLPGLFGEPGPLGRATWAVPTVR SGWIQGLRSLAQHPSALRFLADHGAVDTIFSLQGDSSLFVASAASQLLVHVLALSMRGGA EGQPCLPGGDWPACAQKIMDHVEESLCSAATPKVTQALNVLTTTFGRCQSPWTEALWVRL SPRVACLLERDPIPAAHSFVDLLLCVARSPVFSSSDGSLWETVARALSCLGPTHMGPLAL GILKLEHCPQALRTQAFQVLLQPLACVLKATVQAPGPPGLLDGTADDATTVDTLLASKSS CAGLLCRTLAHLEELQPLPQRPSPWPQASLLGATVTVLRLCDGSAAPASSVGGHLCGTLA GCVRVQRAALDFLGTLSQGTGPQELVTQALAVLLECLESPGSSPTVLKKAFQATLRWLLS SPKTPGCSDLGPLIPQFLRELFPVLQKRLCHPCWEVRDSALEFLTQLSRHWGGQADFRCA LLASEVPQLALQLLQDPESYVRASAVTAMGQLSSQGLHAPTSPEHAEARQSLFLELLHIL SVDSEGFPRRAVMQVFTEWLRDGHADAAQDTEQFVATVLQAASRDLDWEVRAQGLELALV FLGQTLGPPRTHCPYAVALPEVAPAQPLTEALRALCHVGLFDFAFCALFDCDRPVAQKSC DLLLFLRDKIASYSSLREARGSPNTASAEATLPRWRAGEQAQPPGDQEPEAVLAMLRSLD LEGLRSTLAESSDHVEKSPQSLLQDMLATGGFLQGDEADCY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(47)-g, cdbSNP:145252383
complement(124)-g, cdbSNP:183874963
complement(166)-g, adbSNP:62442590
complement(173)-t, cdbSNP:370704580
complement(246)-c, adbSNP:112518389
complement(261)-g, cdbSNP:117219938
complement(282)-dbSNP:
complement(282)-g, adbSNP:200174537
complement(292)-c, adbSNP:370035153
complement(314)-g, adbSNP:375713332
complement(343)-g, adbSNP:373874434
complement(346)-t, cdbSNP:17856488
complement(347)-c, adbSNP:143390199
complement(446)-dbSNP:
complement(446)-g, cdbSNP:368397368
complement(454)-t, g, cdbSNP:148548421
complement(467)-g, cdbSNP:373847223
complement(504)-g, adbSNP:370459360
complement(633)-dbSNP:
complement(633)-g, adbSNP:200605265
complement(642)-g, adbSNP:148913309
complement(649)-t, gdbSNP:138585448
complement(652)-t, cdbSNP:368753862
complement(671)-t, cdbSNP:369391505
complement(712)-t, cdbSNP:183545975
complement(716)-t, gdbSNP:150127675
complement(719)-dbSNP:
complement(719)-t, cdbSNP:199745325
complement(722)-g, adbSNP:140833277
complement(756)-g, adbSNP:369784573
complement(762)-t, cdbSNP:141198732
complement(780)-g, adbSNP:375295992
complement(793)-c, adbSNP:199582351
complement(798)-g, adbSNP:142971567
complement(833)-t, cdbSNP:148598276
complement(849)-t, cdbSNP:377655983
complement(864)-g, adbSNP:374294371
complement(866)-g, adbSNP:144841598
complement(874)-g, cdbSNP:149814450
complement(892)-t, cdbSNP:140943156
complement(912)-g, adbSNP:369792998
complement(914)-g, adbSNP:112960104
complement(937)-t, cdbSNP:377386985
complement(942)-g, cdbSNP:147160709
complement(945)-g, adbSNP:143559840
complement(960)-g, cdbSNP:373177343
complement(963)-g, adbSNP:139443843
complement(967)-g, adbSNP:79263074
complement(986)-g, adbSNP:138784645
complement(987)-t, cdbSNP:61753095
complement(993)-g, cdbSNP:141151507
complement(1004)-t, cdbSNP:200536814
complement(1016)-t, cdbSNP:148261595
complement(1018)-t, cdbSNP:199801652
complement(1050)-g, adbSNP:143192367
complement(1051)-t, cdbSNP:149503475
complement(1053)-g, adbSNP:370715572
complement(1058)-t, gdbSNP:201957861
complement(1062)-t, cdbSNP:376321695
complement(1074)-g, cdbSNP:138059744
complement(1090)-g, adbSNP:145047426
complement(1096)-dbSNP:
complement(1096)-g, adbSNP:200455714
complement(1104)-g, cdbSNP:374694299
complement(1110)-g, adbSNP:371711348
complement(1113)-g, adbSNP:141320181
complement(1114)-t, cdbSNP:146546197
complement(1142)-t, cdbSNP:77213198
complement(1154)-g, cdbSNP:140451075
complement(1162)-g, adbSNP:200215583
complement(1164)-g, cdbSNP:113279845
complement(1171)-t, cdbSNP:151317339
complement(1172)-t, adbSNP:201041622
complement(1197)-t, cdbSNP:61742752
complement(1204)-t, cdbSNP:367771169
complement(1243)-dbSNP:
complement(1243)-t, cdbSNP:140903769
complement(1250)-c, adbSNP:150942467
complement(1251)-g, cdbSNP:181738663
complement(1281)-t, cdbSNP:76646873
complement(1300)-g, adbSNP:373020561
complement(1319)-dbSNP:
complement(1319)-g, adbSNP:371239207
complement(1320)-t, cdbSNP:371220513
complement(1326)-g, adbSNP:139509070
complement(1327)-t, cdbSNP:144499760
complement(1334)-g, adbSNP:112658000
complement(1338)-t, cdbSNP:111276768
complement(1387)-g, adbSNP:139472984
complement(1395)-t, cdbSNP:372833320
complement(1440)-dbSNP:
complement(1440)-t, cdbSNP:185653171
complement(1451)-g, adbSNP:368710298
complement(1452)-t, cdbSNP:201141165
complement(1465)-t, cdbSNP:35659709
complement(1484)-t, cdbSNP:371360176
complement(1491)-g, adbSNP:191610171
complement(1494)-g, adbSNP:7807895
complement(1510)-t, cdbSNP:374020018
complement(1526)-t, cdbSNP:370618913
complement(1536)-c, adbSNP:377415829
complement(1540)-t, adbSNP:202145442
complement(1541)-t, gdbSNP:150583862
complement(1555)-t, g, cdbSNP:141807337
complement(1559)-t, cdbSNP:374524068
complement(1568)-t, cdbSNP:375466838
complement(1579)-t, cdbSNP:138016332
complement(1584)-g, adbSNP:141653707
complement(1585)-g, c, adbSNP:147978414
complement(1593)-c, adbSNP:145506790
complement(1606)-t, adbSNP:141751133
complement(1628)-dbSNP:
complement(1628)-g, adbSNP:368808380
complement(1639)-c, adbSNP:138276986
complement(1655)-c, adbSNP:377494515
complement(1659)-g, adbSNP:368441113
complement(1666)-g, adbSNP:373935601
complement(1679)-g, adbSNP:143718509
complement(1683)-t, c, adbSNP:201855243
complement(1698)-dbSNP:
complement(1698)-g, cdbSNP:371170298
complement(1709)-g, adbSNP:148923187
complement(1734)-g, cdbSNP:374233073
complement(1739)-g, cdbSNP:200248064
complement(1755)-g, adbSNP:145727035
complement(1766)-c, adbSNP:150268284
complement(1775)-t, cdbSNP:142667367
complement(1795)-dbSNP:
complement(1795)-g, adbSNP:147745609
complement(1811)-t, cdbSNP:377427021
complement(1816)-c, adbSNP:376165927
complement(1852)-g, cdbSNP:145509776
complement(1858)-g, cdbSNP:140095103
complement(1867)-g, adbSNP:151161353
complement(1882)-t, cdbSNP:142129866
complement(1906)-dbSNP:
complement(1906)-t, cdbSNP:148608404
complement(1924)-c, adbSNP:34656552
complement(1944)-g, cdbSNP:376177219
complement(1947)-g, adbSNP:61746940
complement(1968)-g, adbSNP:370935312
complement(1977)-t, cdbSNP:146276208
complement(1981)-t, cdbSNP:200932983
complement(1989)-g, adbSNP:199766692
complement(1990)-t, cdbSNP:141709461
complement(2009)-g, cdbSNP:376495785
complement(2014)-t, g, cdbSNP:61740320
complement(2015)-g, cdbSNP:150846882
complement(2018)-g, adbSNP:367915169
complement(2028..2029)-, gdbSNP:35951475
complement(2028)-g, adbSNP:200084998
complement(2053)-t, g, adbSNP:141490198
complement(2054)-c, adbSNP:375281590
complement(2065)-dbSNP:
complement(2065)-g, adbSNP:374708849
complement(2080)-g, adbSNP:201523118
complement(2086)-g, adbSNP:56727079
complement(2098)-c, adbSNP:199501131
complement(2116)-g, adbSNP:61753094
complement(2149)-g, adbSNP:148297849
complement(2150)-t, cdbSNP:138077616
complement(2154)-t, gdbSNP:371142628
complement(2155)-t, cdbSNP:77015302
complement(2166)-g, adbSNP:369763195
complement(2172)-g, adbSNP:142346283
complement(2191)-t, cdbSNP:373392231
complement(2205)-t, cdbSNP:369737188
complement(2210)-g, adbSNP:113030000
2211+a, gdbSNP:2917726
complement(2213)-g, cdbSNP:200502048
complement(2219..2220)-ct, tcdbSNP:71531463
complement(2219)-t, cdbSNP:4719553
complement(2219)-, cdbSNP:374879575
complement(2220)-t, cdbSNP:4719552
complement(2221..2222)-, cdbSNP:35445563
complement(2229)-g, adbSNP:376101375
complement(2260)-t, cdbSNP:186448943
complement(2276)-t, cdbSNP:61627394
complement(2283)-c, adbSNP:371847594
complement(2292)-t, cdbSNP:368232132
complement(2295)-t, cdbSNP:372436637
complement(2296)-g, adbSNP:368449590
complement(2297)-t, cdbSNP:147119058
complement(2316)-g, adbSNP:376186402
complement(2317)-t, cdbSNP:141726264
complement(2329)-t, cdbSNP:145833100
complement(2355)-g, adbSNP:199957832
complement(2363)-c, adbSNP:373211828
complement(2376)-g, adbSNP:369595259
complement(2379)-g, adbSNP:200264530
complement(2382)-t, cdbSNP:375314310
complement(2421)-g, adbSNP:149690979
complement(2435)-g, adbSNP:140802292
complement(2454)-g, adbSNP:372332387
complement(2457)-t, adbSNP:150300694
complement(2477)-g, adbSNP:143963658
complement(2487)-g, adbSNP:139111440
complement(2496)-c, adbSNP:61753093
complement(2497)-g, adbSNP:60152725
complement(2516)-t, gdbSNP:148661872
complement(2530)-t, cdbSNP:373538456
complement(2532)-t, cdbSNP:369152767
complement(2542)-g, adbSNP:140546659
complement(2546)-g, adbSNP:199914857
complement(2547)-t, cdbSNP:376271902
complement(2551)-t, adbSNP:373302503
complement(2555)-t, cdbSNP:35955968
complement(2558)-g, adbSNP:369064014
complement(2586)-t, gdbSNP:144085416
complement(2589)-t, cdbSNP:376888751
complement(2592)-t, cdbSNP:368044267
complement(2609)-g, adbSNP:372230882
complement(2619)-g, cdbSNP:369607597
complement(2628)-g, cdbSNP:201045158
complement(2641)-g, adbSNP:61729932
complement(2648)-g, adbSNP:375916445
complement(2655)-g, adbSNP:200892967
2676+a, gdbSNP:1043291
complement(2686..2687)-, gdbSNP:35099363
complement(2713)-t, gdbSNP:61733815
complement(2736)-g, adbSNP:200784213
complement(2758)-t, cdbSNP:61755262
complement(2764)-g, cdbSNP:190232808
2766+c, gdbSNP:1043294
complement(2768)-g, adbSNP:140062589
2812+c, tdbSNP:1043297
complement(2850)-g, adbSNP:148220310
complement(2861)-t, gdbSNP:184247341
2905+a, cdbSNP:1043299
2973+g, tdbSNP:145828184
complement(2981)-g, cdbSNP:185916558
Gene SymbolBRAT1
Gene SynonymBAAT1; C7orf27; RMFSL
Chromosome7
Locus Map7p22.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_152743 Homo sapiens BRCA1-associated ATM activator 1 (BRAT1), mRNA. On-demand $899.00 20
XM_006715657 PREDICTED: Homo sapiens BRCA1-associated ATM activator 1 (BRAT1), transcript variant X5, mRNA. On-demand $899.00 20
XM_005249642 PREDICTED: Homo sapiens BRCA1-associated ATM activator 1 (BRAT1), transcript variant X1, mRNA. On-demand $899.00 20
XM_005249643 PREDICTED: Homo sapiens BRCA1-associated ATM activator 1 (BRAT1), transcript variant X2, mRNA. On-demand $899.00 20
XM_005249644 PREDICTED: Homo sapiens BRCA1-associated ATM activator 1 (BRAT1), transcript variant X3, mRNA. On-demand $849.00 20
XM_005249645 PREDICTED: Homo sapiens BRCA1-associated ATM activator 1 (BRAT1), transcript variant X4, mRNA. On-demand $849.00 20
XM_006715658 PREDICTED: Homo sapiens BRCA1-associated ATM activator 1 (BRAT1), transcript variant X6, mRNA. On-demand $699.00 18
Title Structural basis for the BRCA1 BRCT interaction with the proteins .
Author Liu X and Ladias JA.
Journal Biochemistry 52 (43), 7618-7627 (2013)
Title Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population .
Author Comuzzie AG, Cole SA, Laston SL, Voruganti VS, Haack K, Gibbs RA and Butte NF.
Journal PLoS ONE 7 (12), E51954 (2012)
Title Genetic mapping and exome sequencing identify variants associated with five novel diseases .
Author Puffenberger EG, Jinks RN, Sougnez C, Cibulskis K, Willert RA, Achilly NP, Cassidy RP, Fiorentini CJ, Heiken KF, Lawrence JJ, Mahoney MH, Miller CJ, Nair DT, Politi KA, Worcester KN, Setton RA, Dipiazza R, Sherman EA, Eastman JT, Francklyn C, Robey-Bond S, Rider NL, Gabriel S, Morton DH and Strauss KA.
Journal PLoS ONE 7 (1), E28936 (2012)
Title ATM activation by ionizing radiation requires BRCA1-associated BAAT1 .
Author Aglipay JA, Martin SA, Tawara H, Lee SW and Ouchi T.
Journal J. Biol. Chem. 281 (14), 9710-9718 (2006)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.