• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_152854 Homo sapiens CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 2, mRNA. GenEZ ORF Cloning On-demand $399.00 14

*Business Day

Related Services

RefSeq Version NM_152854.2, 91105277
Length 1554 bp
Structure linear
Update Date 16-MAR-2014
Organism Homo sapiens (human)
Definition Homo sapiens CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 2, mRNA.
Product tumor necrosis factor receptor superfamily member 5 isoform 2 precursor
Comment

Summary: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been found to be essential in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (2) lacks a coding segment, which leads to a translation frame shift, compared to variant 1. The resulting isoform (2) contains a shorter and distinct C-terminus, compared to isoform 1.

RefSeq NP_690593.1
CDS 78..689
Misc Feature(1)150..257
Misc Feature(2)153..446
Misc Feature(3)order(153..158,276..278,309..311,342..344,408..410,
Misc Feature(4)order(165..167,192..194,204..206,210..212,249..251,
Misc Feature(5)order(192..221,246..260,363..371)
Misc Feature(6)258..386
Misc Feature(7)order(285..290,306..314)
Misc Feature(8)387..509
Misc Feature(9)390..506
Misc Feature(10)order(408..410,432..446)
Misc Feature(11)450..>566
Misc Feature(12)order(450..473,498..512)
Misc Feature(13)order(456..458,462..464,501..503,510..512,540..542)
Misc Feature(14)order(537..542,558..566)
Exon (1)1..128
Gene:CD40
Gene Synonym:Bp50; CDW40; p50; TNFRSF5
Exon (2)129..207
Gene:CD40
Gene Synonym:Bp50; CDW40; p50; TNFRSF5
Exon (3)208..333
Gene:CD40
Gene Synonym:Bp50; CDW40; p50; TNFRSF5
Exon (4)334..480
Gene:CD40
Gene Synonym:Bp50; CDW40; p50; TNFRSF5
Exon (5)481..574
Gene:CD40
Gene Synonym:Bp50; CDW40; p50; TNFRSF5
Exon (6)575..661
Gene:CD40
Gene Synonym:Bp50; CDW40; p50; TNFRSF5
Exon (7)662..690
Gene:CD40
Gene Synonym:Bp50; CDW40; p50; TNFRSF5
Exon (8)691..1554
Gene:CD40
Gene Synonym:Bp50; CDW40; p50; TNFRSF5
Translation MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECL PCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV LHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTRSPGSAESPGGDPHH LRDPVCHPLGAGLYQKGGQEANQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Gene SymbolCD40
Gene SynonymBp50; CDW40; p50; TNFRSF5
Chromosome20
Locus Map20q12-q13.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_152854 Homo sapiens CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 2, mRNA. On-demand $399.00 14
NM_001250 Homo sapiens CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 1, mRNA. In-stock $348.00 $299.00 10
XM_005260617 PREDICTED: Homo sapiens CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant X1, mRNA. On-demand $449.00 14
XM_005260618 PREDICTED: Homo sapiens CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant X2, mRNA. On-demand $399.00 14
XM_006723889 PREDICTED: Homo sapiens CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant X4, mRNA. On-demand $399.00 14
XM_005260619 PREDICTED: Homo sapiens CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant X3, mRNA. On-demand $399.00 14
Title Circulating CD40+ and CD86+ B cell subsets demonstrate opposing associations with risk of stroke .
Author Mantani PT, Ljungcrantz I, Andersson L, Alm R, Hedblad B, Bjorkbacka H, Nilsson J and Fredrikson GN.
Journal Arterioscler. Thromb. Vasc. Biol. 34 (1), 211-218 (2014)
Title CD154 is released from T-cells by a disintegrin and metalloproteinase domain-containing protein 10 (ADAM10) and ADAM17 in a CD40 protein-dependent manner .
Author Yacoub D, Benslimane N, Al-Zoobi L, Hassan G, Nadiri A and Mourad W.
Journal J. Biol. Chem. 288 (50), 36083-36093 (2013)
Title Single nucleotide polymorphism of CD40 in the 5'-untranslated region is associated with ischemic stroke .
Author Ma Y, Wang SX, Liu Y, Peng GG, Wang XM, Zhang B, Wu BH and Yu JM.
Journal Gene 529 (2), 257-261 (2013)
Title TWEAK inhibits TRAF2-mediated CD40 signaling by destabilization of CD40 signaling complexes .
Author Salzmann S, Lang I, Rosenthal A, Schafer V, Weisenberger D, Carmona Arana JA, Trebing J, Siegmund D, Neumann M and Wajant H.
Journal J. Immunol. 191 (5), 2308-2318 (2013)
Title CD40 signal regulates CXCR4 mediating ovarian carcinoma cell migration: implications for extrapelvic metastastic factors .
Author Qu QX, Huang Q, Xu J, Duan LT, Zhu YB and Zhang XG.
Journal Oncol. Res. 20 (9), 383-392 (2013)
Title gp39-CD40 interactions are essential for germinal center formation and the development of B cell memory .
Author Foy TM, Laman JD, Ledbetter JA, Aruffo A, Claassen E and Noelle RJ.
Journal J. Exp. Med. 180 (1), 157-163 (1994)
Title The CD40 antigen and its ligand .
Author Banchereau J, Bazan F, Blanchard D, Briere F, Galizzi JP, van Kooten C, Liu YJ, Rousset F and Saeland S.
Journal Annu. Rev. Immunol. 12, 881-922 (1994)
Title A B-lymphocyte activation molecule related to the nerve growth factor receptor and induced by cytokines in carcinomas .
Author Stamenkovic I, Clark EA and Seed B.
Journal EMBO J. 8 (5), 1403-1410 (1989)
Title Activation of human B cells mediated through two distinct cell surface differentiation antigens, Bp35 and Bp50 .
Author Clark,E.A. and Ledbetter,J.A.
Journal Proc. Natl. Acad. Sci. U.S.A. 83 (12), 4494-4498 (1986)
Title A p50 surface antigen restricted to human urinary bladder carcinomas and B lymphocytes .
Author Paulie,S., Ehlin-Henriksson,B., Mellstedt,H., Koho,H., Ben-Aissa,H. and Perlmann,P.
Journal Cancer Immunol. Immunother. 20 (1), 23-28 (1985)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.