• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_152854 Homo sapiens CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 2, mRNA. GenEZ ORF Cloning On-demand $399.00 14

*Business Day

Related Services

RefSeq Version NM_152854.2, 91105277
Length 1554 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 2, mRNA.
Product tumor necrosis factor receptor superfamily member 5 isoform 2 precursor
Comment

Summary: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been found to be essential in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (2) lacks a coding segment, which leads to a translation frame shift, compared to variant 1. The resulting isoform (2) contains a shorter and distinct C-terminus, compared to isoform 1.

RefSeq NP_690593.1
CDS 78..689
Misc Feature(1)150..257
Misc Feature(2)153..446
Misc Feature(3)order(153..158,276..278,309..311,342..344,408..410,
Misc Feature(4)order(165..167,192..194,204..206,210..212,249..251,
Misc Feature(5)order(192..221,246..260,363..371)
Misc Feature(6)258..386
Misc Feature(7)order(285..290,306..314)
Misc Feature(8)387..509
Misc Feature(9)390..506
Misc Feature(10)order(408..410,432..446)
Exon (1)1..128
Gene:CD40
Gene Synonym:Bp50; CDW40; p50; TNFRSF5
Exon (2)129..207
Gene:CD40
Gene Synonym:Bp50; CDW40; p50; TNFRSF5
Exon (3)208..333
Gene:CD40
Gene Synonym:Bp50; CDW40; p50; TNFRSF5
Exon (4)334..480
Gene:CD40
Gene Synonym:Bp50; CDW40; p50; TNFRSF5
Exon (5)481..574
Gene:CD40
Gene Synonym:Bp50; CDW40; p50; TNFRSF5
Exon (6)575..661
Gene:CD40
Gene Synonym:Bp50; CDW40; p50; TNFRSF5
Exon (7)662..690
Gene:CD40
Gene Synonym:Bp50; CDW40; p50; TNFRSF5
Exon (8)691..1554
Gene:CD40
Gene Synonym:Bp50; CDW40; p50; TNFRSF5
Translation MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECL PCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV LHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTRSPGSAESPGGDPHH LRDPVCHPLGAGLYQKGGQEANQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
9+dbSNP:
9+, tdbSNP:11569300
37+c, tdbSNP:11569301
65+g, tdbSNP:200981957
75+a, gdbSNP:140399416
77+c, tdbSNP:1883832
99+g, tdbSNP:113207193
150+dbSNP:
150+g, tdbSNP:147677886
248+dbSNP:
248+a, gdbSNP:115724543
272+a, cdbSNP:202208745
281+a, gdbSNP:142258778
288+, tdbSNP:11478618
307+g, tdbSNP:17855908
311+a, cdbSNP:17177493
324+c, tdbSNP:28931586
345+dbSNP:
345+c, tdbSNP:144542285
422+c, tdbSNP:147816161
448+c, tdbSNP:11569321
455+a, gdbSNP:150312341
467+g, tdbSNP:1801293
477+a, c, gdbSNP:61760052
551+dbSNP:
551+a, c, tdbSNP:79661585
621+dbSNP:
621+c, tdbSNP:7273698
625+a, gdbSNP:143037975
637+a, gdbSNP:199581355
694+dbSNP:
694+c, gdbSNP:11086998
696+c, tdbSNP:148342289
732+c, tdbSNP:144466131
735+c, tdbSNP:147672904
769+c, tdbSNP:199980487
795+a, gdbSNP:150890139
824+a, gdbSNP:139300926
939+g, tdbSNP:6131019
984+c, gdbSNP:11569343
1160+c, tdbSNP:41282790
1165+c, gdbSNP:11569344
1221+a, cdbSNP:117490488
1396+a, tdbSNP:184942163
1429+c, tdbSNP:6094253
1462+c, tdbSNP:41282792
Gene SymbolCD40
Gene SynonymBp50; CDW40; p50; TNFRSF5
Chromosome20
Locus Map20q12-q13.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001250 Homo sapiens CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 1, mRNA. In-stock $348.00 $299.00 10
NM_152854 Homo sapiens CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 2, mRNA. On-demand $399.00 14
Title CD40/CD154 blockade inhibits dendritic cell expression of inflammatory cytokines but not costimulatory molecules .
Author Ferrer,I.R., Liu,D., Pinelli,D.F., Koehn,B.H., Stempora,L.L. and Ford,M.L.
Journal J. Immunol. 189 (9), 4387-4395 (2012)
Title Interleukin-6 production in CD40-engaged fibrocytes in thyroid-associated ophthalmopathy: involvement of Akt and NF-kappaB .
Author Gillespie,E.F., Raychaudhuri,N., Papageorgiou,K.I., Atkins,S.J., Lu,Y., Charara,L.K., Mester,T., Smith,T.J. and Douglas,R.S.
Journal Invest. Ophthalmol. Vis. Sci. 53 (12), 7746-7753 (2012)
Title Genetically driven target tissue overexpression of CD40: a novel mechanism in autoimmune disease .
Author Huber,A.K., Finkelman,F.D., Li,C.W., Concepcion,E., Smith,E., Jacobson,E., Latif,R., Keddache,M., Zhang,W. and Tomer,Y.
Journal J. Immunol. 189 (6), 3043-3053 (2012)
Title Aberrant CD40-induced NF-kappaB activation in human lupus B lymphocytes .
Author Zhang,W., Shi,Q., Xu,X., Chen,H., Lin,W., Zhang,F., Zeng,X., Zhang,X., Ba,D. and He,W.
Journal PLoS ONE 7 (8), E41644 (2012)
Title The germinal center kinase TNIK is required for canonical NF-kappaB and JNK signaling in B-cells by the EBV oncoprotein LMP1 and the CD40 receptor .
Author Shkoda,A., Town,J.A., Griese,J., Romio,M., Sarioglu,H., Knofel,T., Giehler,F. and Kieser,A.
Journal PLoS Biol. 10 (8), E1001376 (2012)
Title gp39-CD40 interactions are essential for germinal center formation and the development of B cell memory .
Author Foy,T.M., Laman,J.D., Ledbetter,J.A., Aruffo,A., Claassen,E. and Noelle,R.J.
Journal J. Exp. Med. 180 (1), 157-163 (1994)
Title The CD40 antigen and its ligand .
Author Banchereau,J., Bazan,F., Blanchard,D., Briere,F., Galizzi,J.P., van Kooten,C., Liu,Y.J., Rousset,F. and Saeland,S.
Journal Annu. Rev. Immunol. 12, 881-922 (1994)
Title A B-lymphocyte activation molecule related to the nerve growth factor receptor and induced by cytokines in carcinomas .
Author Stamenkovic,I., Clark,E.A. and Seed,B.
Journal EMBO J. 8 (5), 1403-1410 (1989)
Title Activation of human B cells mediated through two distinct cell surface differentiation antigens, Bp35 and Bp50 .
Author Clark,E.A. and Ledbetter,J.A.
Journal Proc. Natl. Acad. Sci. U.S.A. 83 (12), 4494-4498 (1986)
Title A p50 surface antigen restricted to human urinary bladder carcinomas and B lymphocytes .
Author Paulie,S., Ehlin-Henriksson,B., Mellstedt,H., Koho,H., Ben-Aissa,H. and Perlmann,P.
Journal Cancer Immunol. Immunother. 20 (1), 23-28 (1985)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.