• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens membrane-spanning 4-domains, subfamily A, member 1 (MS4A1), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu00965 Homo sapiens membrane-spanning 4-domains, subfamily A, member 1 (MS4A1), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $159.00 7-9
OHu00965C Homo sapiens membrane-spanning 4-domains, subfamily A, member 1 (MS4A1), transcript variant 1, mRNA. Customized vector On-demand $209.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_152866.2, 68348720
Length 894 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens membrane-spanning 4-domains, subfamily A, member 1 (MS4A1), transcript variant 1, mRNA.
Product B-lymphocyte antigen CD20
Comment

Summary: This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longer transcript variant. Variants 1 and 3 both encode the same protein.

RefSeq NP_690605.1
CDS 417..1310
Misc Feature(1)342..344
Misc Feature(2)567..1064
Misc Feature(3)567..1064
Misc Feature(4)585..650
Misc Feature(5)636..656
Misc Feature(6)669..731
Misc Feature(7)777..839
Misc Feature(8)852..896
Misc Feature(9)918..941
Misc Feature(10)981..1043
Misc Feature(11)1107..1109
Misc Feature(12)1107..1109
Misc Feature(13)1164..1166
Misc Feature(14)1164..1166
Misc Feature(15)1281..1283
Misc Feature(16)1281..1283
Exon (1)1..137
Gene:MS4A1
Gene Synonym:B1; Bp35; CD20; CVID5; LEU-16; MS4A2; S7
Exon (2)138..226
Gene:MS4A1
Gene Synonym:B1; Bp35; CD20; CVID5; LEU-16; MS4A2; S7
Exon (3)227..575
Gene:MS4A1
Gene Synonym:B1; Bp35; CD20; CVID5; LEU-16; MS4A2; S7
Exon (4)576..695
Gene:MS4A1
Gene Synonym:B1; Bp35; CD20; CVID5; LEU-16; MS4A2; S7
Exon (5)696..752
Gene:MS4A1
Gene Synonym:B1; Bp35; CD20; CVID5; LEU-16; MS4A2; S7
Exon (6)753..989
Gene:MS4A1
Gene Synonym:B1; Bp35; CD20; CVID5; LEU-16; MS4A2; S7
Exon (7)990..1091
Gene:MS4A1
Gene Synonym:B1; Bp35; CD20; CVID5; LEU-16; MS4A2; S7
Exon (8)1092..3594
Gene:MS4A1
Gene Synonym:B1; Bp35; CD20; CVID5; LEU-16; MS4A2; S7
Translation MTTPRNSVNGTFPAEPMKGPIAMQSGPKPLFRRMSSLVGPTQSFFMRESKTLGAVQIMNG LFHIALGGLLMIPAGIYAPICVTVWYPLWGGIMYIISGSLLAATEKNSRKCLVKGKMIMN SLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPST QYCYSIQSLFLGILSVMLIFAFFQELVIAGIVENEWKRTCSRPKSNIVLLSAEEKKEQTI EIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
1+dbSNP:
1+a, gdbSNP:199754716
33+a, tdbSNP:200391810
35+c, tdbSNP:201312204
38+c, tdbSNP:199578569
53+c, tdbSNP:200776423
56+a, gdbSNP:202050207
66+a, cdbSNP:199819632
87+c, tdbSNP:200534988
105+c, tdbSNP:201746270
118+c, tdbSNP:200072026
129+a, gdbSNP:201316341
209+dbSNP:
209+a, tdbSNP:191494696
241+dbSNP:
241+a, cdbSNP:201746563
246+c, tdbSNP:17155019
257+a, gdbSNP:185465207
265+c, tdbSNP:201743339
266+a, gdbSNP:199522190
289+a, gdbSNP:200336617
325+a, gdbSNP:201423696
329+g, tdbSNP:199757094
332+c, tdbSNP:200821362
356+a, gdbSNP:201585011
367+c, gdbSNP:199588228
426+c, tdbSNP:200768099
428+a, cdbSNP:202047596
436+c, gdbSNP:369817025
454+c, tdbSNP:143807889
455+a, gdbSNP:34109768
466+c, tdbSNP:201491900
473+c, tdbSNP:200040848
486+c, tdbSNP:201354938
495+c, tdbSNP:374943331
501+c, tdbSNP:200970156
515+a, gdbSNP:201675666
527+c, gdbSNP:200805059
538+c, tdbSNP:147754874
539+a, gdbSNP:150061756
542+a, gdbSNP:201070226
570+c, g, tdbSNP:202217903
571..572+, gdbSNP:34002466
591+dbSNP:
591+a, cdbSNP:370887454
609..610+, cdbSNP:34514648
610+c, tdbSNP:146626926
619+a, gdbSNP:370620216
624+c, tdbSNP:79703274
632+c, tdbSNP:2070770
633+c, gdbSNP:143621504
651+a, cdbSNP:199747240
666+a, gdbSNP:200832581
678+a, cdbSNP:116433863
707+dbSNP:
707+c, tdbSNP:201962059
708+a, gdbSNP:371479947
718+c, tdbSNP:374938733
727+c, gdbSNP:201665706
728+a, gdbSNP:200265912
731+a, gdbSNP:267603055
744+a, gdbSNP:201361363
767+dbSNP:
767+g, tdbSNP:373461527
768+a, cdbSNP:201245387
769+c, tdbSNP:199860984
792+c, gdbSNP:200487438
830+a, gdbSNP:148966123
871+c, tdbSNP:201495118
882+a, gdbSNP:200103669
923+a, cdbSNP:143708987
924+c, gdbSNP:370796845
947+c, tdbSNP:200828104
948+c, tdbSNP:201784186
951+c, tdbSNP:193204741
966+c, tdbSNP:199935456
967+a, gdbSNP:201085465
972+a, cdbSNP:375847581
1013+dbSNP:
1013+c, tdbSNP:184174552
1050+a, gdbSNP:148035107
1059+a, gdbSNP:202204878
1062+c, tdbSNP:200449073
1069+a, gdbSNP:201238245
1072+c, tdbSNP:188842906
1082+a, gdbSNP:202117565
1100+dbSNP:
1100+c, tdbSNP:199791821
1102+g, tdbSNP:200395483
1134+a, gdbSNP:201410977
1162+c, tdbSNP:199574237
1178+c, tdbSNP:200879124
1196+a, cdbSNP:201861406
1232+a, gdbSNP:201050736
1235+a, gdbSNP:199815651
1246+c, tdbSNP:200527465
1261+a, cdbSNP:372609277
1269+a, gdbSNP:147927720
1295+c, tdbSNP:146194368
1315+c, tdbSNP:200077365
1325+c, tdbSNP:201161107
1350+g, tdbSNP:201836816
1351+c, tdbSNP:199924787
1357+a, c, tdbSNP:201192611
1372+a, cdbSNP:202089260
1383+c, tdbSNP:200397280
1385+c, tdbSNP:200785869
1404+c, tdbSNP:201730785
1408+c, g, tdbSNP:186409966
1409+a, gdbSNP:201574956
1411+a, cdbSNP:199520538
1413+a, cdbSNP:200295884
1420+c, gdbSNP:12800620
1424+a, cdbSNP:201536499
1429+c, tdbSNP:199753311
1436+g, tdbSNP:148993277
1442+a, gdbSNP:201591426
1465+a, gdbSNP:199625336
1466+c, tdbSNP:200872082
1474+a, gdbSNP:201813166
1490+a, gdbSNP:200184944
1493+a, gdbSNP:35930599
1498+c, tdbSNP:201964094
1509+c, tdbSNP:189633925
1510+a, gdbSNP:73483134
1527+a, gdbSNP:201677991
1543+a, gdbSNP:199983028
1549+c, tdbSNP:148229051
1561+c, tdbSNP:202092127
1578+c, tdbSNP:200636008
1584+a, cdbSNP:201367222
1611+c, tdbSNP:372583249
1615..1616+, tdbSNP:34273920
1625+g, tdbSNP:202019617
complement(1641)-t, cdbSNP:1051756
1641+c, tdbSNP:386514170
1656+a, gdbSNP:201494850
1657+c, tdbSNP:199813136
1683+c, tdbSNP:200648213
1689+a, gdbSNP:201563749
1691+c, tdbSNP:199698823
1702+c, tdbSNP:200940219
1709+c, tdbSNP:201303899
1713+a, tdbSNP:199991623
1720+c, tdbSNP:200613815
1726+c, tdbSNP:201552453
1727+a, gdbSNP:200193401
1734+a, gdbSNP:201003714
1748+c, gdbSNP:202201111
1754+c, tdbSNP:200009543
1761+a, gdbSNP:141211968
1770+(a)8, 9dbSNP:35374361
1770+a, tdbSNP:201311564
1813+c, tdbSNP:201955982
1822+a, gdbSNP:200214669
1831+a, cdbSNP:201351594
1876+g, tdbSNP:202130852
1890+a, gdbSNP:76267399
1891+c, tdbSNP:145209182
1893+c, tdbSNP:199572946
1897+c, tdbSNP:200764520
1904+c, tdbSNP:201247814
1913+a, cdbSNP:199865052
1916+a, gdbSNP:200487626
1927+a, cdbSNP:201493823
1961+c, tdbSNP:114470736
1963+a, cdbSNP:200945733
1972+a, tdbSNP:201628676
1974+g, tdbSNP:200018414
1982+a, tdbSNP:200993614
1989+c, tdbSNP:201809734
1993+c, tdbSNP:200136695
2004+g, tdbSNP:200909483
2007+c, gdbSNP:202017688
2008+c, tdbSNP:200427955
2009+a, gdbSNP:201343011
2025+a, gdbSNP:201943434
2026+a, gdbSNP:369570028
2028+c, tdbSNP:200336767
2049+a, gdbSNP:201132358
2090+a, gdbSNP:137884191
2099+a, gdbSNP:199790614
2180+c, tdbSNP:35080829
2190+a, cdbSNP:201027934
2213+a, tdbSNP:182349761
2228+a, tdbSNP:142623086
2245+a, gdbSNP:199578420
2257+a, tdbSNP:200774035
2294..2295+, gdbSNP:35930814
2307+a, gdbSNP:146041500
2322+a, gdbSNP:199764100
2346+a, c, gdbSNP:186969494
2397+a, tdbSNP:12287265
2405+a, gdbSNP:199971878
2406+c, tdbSNP:374779981
2437+c, gdbSNP:201137573
2465+c, tdbSNP:201635252
2466..2467+, gdbSNP:34899958
2477+c, tdbSNP:200004523
2489+c, tdbSNP:138664341
2502+c, gdbSNP:202217895
2510+c, tdbSNP:200403114
2536+a, gdbSNP:200790187
2551+c, tdbSNP:201747912
2581+a, gdbSNP:200284201
2603+c, tdbSNP:1051461
2608+a, tdbSNP:191259416
2622+a, gdbSNP:199521187
2648+g, tdbSNP:200316461
2651+c, tdbSNP:201444383
2657+a, gdbSNP:117334147
2685+a, gdbSNP:200770014
2688+g, tdbSNP:149307450
2689+a, gdbSNP:201234122
2698+c, tdbSNP:183010397
2703+a, tdbSNP:199618969
2714+a, gdbSNP:200711448
2720+c, tdbSNP:202015731
2730+g, tdbSNP:200155913
2734+a, gdbSNP:200755814
2747+a, tdbSNP:17155034
2756+c, tdbSNP:200041274
2758+a, gdbSNP:200970608
2777..2778+, gdbSNP:35600635
2778+g, tdbSNP:201675440
complement(2779)-g, adbSNP:3802957
2783+c, gdbSNP:17155041
2823+a, gdbSNP:202224807
2845+a, gdbSNP:200563443
2852+c, tdbSNP:201402129
2869+g, tdbSNP:202008743
2904+a, gdbSNP:142874024
2910+c, tdbSNP:200353147
2944+c, tdbSNP:201491674
2950+a, gdbSNP:199810390
2966+a, c, tdbSNP:73483136
2976+a, cdbSNP:201447352
2979+c, gdbSNP:199740275
2981+a, gdbSNP:200835972
2986+c, tdbSNP:201804653
2992+c, tdbSNP:199989351
2999+c, gdbSNP:200610209
3000+a, gdbSNP:201551199
3004+c, tdbSNP:200172791
3015+c, tdbSNP:201122105
3016+a, gdbSNP:201999008
3049+a, gdbSNP:200045540
3062+a, cdbSNP:188538512
3067+a, tdbSNP:201954295
3072+a, gdbSNP:200205500
3082+a, tdbSNP:201349981
3088+a, gdbSNP:376433712
3092+c, g, tdbSNP:202133624
3101+c, tdbSNP:200569841
3109+c, tdbSNP:192928733
3131+c, tdbSNP:201410616
3132+a, gdbSNP:199580963
3139+a, tdbSNP:200483657
3143+a, gdbSNP:370821261
3182+, adbSNP:35257728
3193+a, gdbSNP:201555882
3202+g, tdbSNP:199858541
3214+c, tdbSNP:200512906
3245+c, gdbSNP:184842320
3257+c, tdbSNP:199720149
3275+c, tdbSNP:188084881
3283+c, tdbSNP:147234865
3293+c, gdbSNP:200820648
3313+c, gdbSNP:201833400
3360+c, tdbSNP:1051593
3366+a, gdbSNP:191400286
3381+g, tdbSNP:201188736
3382+a, cdbSNP:201807262
3421+c, tdbSNP:200139201
3423+c, tdbSNP:1051594
3432+c, tdbSNP:202020121
3447+a, gdbSNP:200454078
3449+c, gdbSNP:201239500
3456+g, tdbSNP:202119351
3480+c, tdbSNP:200293189
3492+a, gdbSNP:201130284
complement(3507)-g, adbSNP:3802954
3508+c, tdbSNP:200365154
3534+g, tdbSNP:201024406
3594+a, cdbSNP:199604086
Gene SymbolMS4A1
Gene SynonymB1; Bp35; CD20; CVID5; LEU-16; MS4A2; S7
Chromosome11
Locus Map11q12
Title CD20 antigen may be expressed by reactive or lymphomatous cells of transformed mycosis fungoides: diagnostic and prognostic impact .
Author Jullie ML, Carlotti M, Vivot A Jr, Beylot-Barry M, Ortonne N, Frouin E, Carlotti A, de Muret A, Balme B, Franck F, Merlio JP and Vergier B.
Journal Am. J. Surg. Pathol. 37 (12), 1845-1854 (2013)
Title High levels of CD20 expression predict good prognosis in chronic lymphocytic leukemia .
Author Fang C, Zhuang Y, Wang L, Fan L, Wu YJ, Zhang R, Zou ZJ, Zhang LN, Yang S, Xu W and Li JY.
Journal Cancer Sci. 104 (8), 996-1001 (2013)
Title Development of an ELISA based bridging assay as a surrogate measure of ADCC .
Author Miller AS, Tejada ML and Gazzano-Santoro H.
Journal J. Immunol. Methods 385 (1-2), 45-50 (2012)
Title Prenyltransferases regulate CD20 protein levels and influence anti-CD20 monoclonal antibody-mediated activation of complement-dependent cytotoxicity .
Author Winiarska M, Nowis D, Bil J, Glodkowska-Mrowka E, Muchowicz A, Wanczyk M, Bojarczuk K, Dwojak M, Firczuk M, Wilczek E, Wachowska M, Roszczenko K, Miaczynska M, Chlebowska J, Basak GW and Golab J.
Journal J. Biol. Chem. 287 (38), 31983-31993 (2012)
Title CD20-positive NK/T-cell lymphoma with indolent clinical course: report of case and review of literature .
Author Jiang QP, Liu SY, Yang YX, Tan XX, Peng J, Xiong ZT and Li Z.
Journal Diagn Pathol 7, 133 (2012)
Title The gene and cDNA for the human high affinity immunoglobulin E receptor beta chain and expression of the complete human receptor .
Author Kuster H, Zhang L, Brini AT, MacGlashan DW and Kinet JP.
Journal J. Biol. Chem. 267 (18), 12782-12787 (1992)
Title Structure of the gene encoding the human B lymphocyte differentiation antigen CD20 (B1) .
Author Tedder TF, Klejman G, Schlossman SF and Saito H.
Journal J. Immunol. 142 (7), 2560-2568 (1989)
Title The gene that encodes the human CD20 (B1) differentiation antigen is located on chromosome 11 near the t(11;14)(q13;q32) translocation site .
Author Tedder TF, Disteche CM, Louie E, Adler DA, Croce CM, Schlossman SF and Saito H.
Journal J. Immunol. 142 (7), 2555-2559 (1989)
Title Molecular cloning of the human B cell CD20 receptor predicts a hydrophobic protein with multiple transmembrane domains .
Author Einfeld DA, Brown JP, Valentine MA, Clark EA and Ledbetter JA.
Journal EMBO J. 7 (3), 711-717 (1988)
Title Isolation and structure of a cDNA encoding the B1 (CD20) cell-surface antigen of human B lymphocytes .
Author Tedder TF, Streuli M, Schlossman SF and Saito H.
Journal Proc. Natl. Acad. Sci. U.S.A. 85 (1), 208-212 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.