• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens prickle homolog 1 (Drosophila) (PRICKLE1), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu22315 Homo sapiens prickle homolog 1 (Drosophila) (PRICKLE1), transcript variant 1, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu22315C Homo sapiens prickle homolog 1 (Drosophila) (PRICKLE1), transcript variant 1, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_153026.2, 222136677
Length 2496 bp
Structure linear
Update Date 10-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens prickle homolog 1 (Drosophila) (PRICKLE1), transcript variant 1, mRNA.
Product prickle-like protein 1
Comment

Summary: This gene encodes a nuclear receptor that may be a negative regulator of the Wnt/beta-catenin signaling pathway. The encoded protein localizes to the nuclear membrane and has been implicated in the nuclear trafficking of the transcription repressors REST/NRSF and REST4. Mutations in this gene have been linked to progressive myoclonus epilepsy. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 3. [provided by RefSeq, Sep 2009].


Transcript Variant: This variant (1) represents the longest transcript. Variants 1-4 encode the same protein.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments.

RefSeq NP_694571.2
CDS 355..2850
Misc Feature(1)328..330
Misc Feature(2)418..708
Misc Feature(3)418..708
Misc Feature(4)730..906
Misc Feature(5)order(730..732,739..741,808..810,817..819,826..828,
Misc Feature(6)919..1086
Misc Feature(7)order(925..927,934..936,988..990,997..999,1006..1008,
Misc Feature(8)1099..1275
Misc Feature(9)order(1105..1107,1114..1116,1171..1173,1186..1188,
Exon (1)1..306
Gene:PRICKLE1
Gene Synonym:EPM1B; RILP
Exon (2)307..486
Gene:PRICKLE1
Gene Synonym:EPM1B; RILP
Exon (3)487..600
Gene:PRICKLE1
Gene Synonym:EPM1B; RILP
Exon (4)601..738
Gene:PRICKLE1
Gene Synonym:EPM1B; RILP
Exon (5)739..942
Gene:PRICKLE1
Gene Synonym:EPM1B; RILP
Exon (6)943..1129
Gene:PRICKLE1
Gene Synonym:EPM1B; RILP
Exon (7)1130..1993
Gene:PRICKLE1
Gene Synonym:EPM1B; RILP
Exon (8)1994..4321
Gene:PRICKLE1
Gene Synonym:EPM1B; RILP
Translation MPLEMEPKMSKLAFGCQRSSTSDDDSGCALEEYAWVPPGLRPEQIQLYFACLPEEKVPYV NSPGEKHRIKQLLYQLPPHDNEVRYCQSLSEEEKKELQVFSAQRKKEALGRGTIKLLSRA VMHAVCEQCGLKINGGEVAVFASRAGPGVCWHPSCFVCFTCNELLVDLIYFYQDGKIHCG RHHAELLKPRCSACDEIIFADECTEAEGRHWHMKHFCCLECETVLGGQRYIMKDGRPFCC GCFESLYAEYCETCGEHIGVDHAQMTYDGQHWHATEACFSCAQCKASLLGCPFLPKQGQI YCSKTCSLGEDVHASDSSDSAFQSARSRDSRRSVRMGKSSRSADQCRQSLLLSPALNYKF PGLSGNADDTLSRKLDDLSLSRQGTSFASEEFWKGRVEQETPEDPEEWADHEDYMTQLLL KFGDKSLFQPQPNEMDIRASEHWISDNMVKSKTELKQNNQSLASKKYQSDMYWAQSQDGL GDSAYGSHPGPASSRRLQELELDHGASGYNHDETQWYEDSLECLSDLKPEQSVRDSMDSL ALSNITGASVDGENKPRPSLYSLQNFEEMETEDCEKMSNMGTLNSSMLHRSAESLKSLSS ELCPEKILPEEKPVHLPVLRRSKSQSRPQQVKFSDDVIDNGNYDIEIRQPPMSERTRRRV YNFEERGSRSHHHRRRRSRKSRSDNALNLVTERKYSPKDRLRLYTPDNYEKFIQNKSARE IQAYIQNADLYGQYAHATSDYGLQNPGMNRFLGLYGEDDDSWCSSSSSSSDSEEEGYFLG QPIPQPRPQRFAYYTDDLSSPPSALPTPQFGQRTTKSKKKKGHKGKNCIIS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(165)-dbSNP:
complement(165)-g, cdbSNP:145508056
complement(174)-t, cdbSNP:117521428
complement(315)-t, cdbSNP:370363439
complement(322)-t, cdbSNP:377567620
complement(341)-t, cdbSNP:200066556
complement(343)-t, cdbSNP:373933563
complement(353)-g, adbSNP:186219547
complement(414)-t, gdbSNP:370960593
complement(455)-g, adbSNP:139176541
complement(462)-g, adbSNP:147268650
complement(467)-g, adbSNP:145493619
complement(468)-t, cdbSNP:141743294
complement(486)-t, cdbSNP:377668062
complement(531)-dbSNP:
complement(531)-g, adbSNP:144843013
complement(538)-t, cdbSNP:140262447
complement(560)-g, adbSNP:141795695
complement(610)-dbSNP:
complement(610)-g, adbSNP:112753281
665+a, gdbSNP:113994140
complement(674)-t, gdbSNP:201983132
complement(678)-t, gdbSNP:143645243
complement(715)-g, cdbSNP:371720624
complement(724)-t, cdbSNP:79087668
complement(728)-g, adbSNP:34837068
complement(745)-dbSNP:
complement(745)-c, adbSNP:35731866
complement(754)-t, gdbSNP:200558941
785+a, gdbSNP:281865563
complement(789)-t, cdbSNP:146650383
complement(825)-g, adbSNP:201613485
complement(834)-t, cdbSNP:376385820
complement(907)-c, adbSNP:61924369
complement(912)-c, adbSNP:199650711
complement(939)-g, adbSNP:74081707
complement(1012)-dbSNP:
complement(1012)-t, cdbSNP:200263143
complement(1023)-t, cdbSNP:201394996
complement(1057)-t, cdbSNP:375197568
complement(1060)-g, adbSNP:372213429
complement(1068)-g, adbSNP:368850875
complement(1074)-g, adbSNP:374695088
complement(1079..1080)-, c, ccdbSNP:148197048
complement(1080)-c, adbSNP:74918611
complement(1098)-t, cdbSNP:34778200
complement(1158)-dbSNP:
complement(1158)-g, adbSNP:371149992
complement(1159)-t, cdbSNP:376845777
complement(1179)-t, cdbSNP:368347802
complement(1264)-t, cdbSNP:202205425
complement(1268)-g, adbSNP:375459191
complement(1269)-t, cdbSNP:150052192
complement(1308)-g, c, adbSNP:139421676
1361+a, cdbSNP:76029235
complement(1377)-g, cdbSNP:370013528
complement(1404)-g, adbSNP:141763288
complement(1503)-t, cdbSNP:375407377
complement(1562)-t, cdbSNP:367941464
complement(1576)-g, adbSNP:376384105
complement(1601)-g, adbSNP:151332996
complement(1602)-t, cdbSNP:142502371
complement(1622)-t, cdbSNP:371689139
complement(1638)-g, adbSNP:183742526
complement(1684)-t, gdbSNP:146199468
complement(1745)-t, cdbSNP:138568653
1768+c, tdbSNP:281865564
complement(1794)-g, cdbSNP:367822804
complement(1797)-g, adbSNP:376123082
complement(1815)-g, adbSNP:116197349
complement(1840)-t, gdbSNP:371789655
complement(1860)-t, cdbSNP:200460878
complement(1865)-t, cdbSNP:201054946
complement(1895)-g, adbSNP:374333566
complement(1901)-g, cdbSNP:139901494
complement(1921)-g, adbSNP:150121787
complement(1957)-g, cdbSNP:371146879
complement(1961)-g, adbSNP:150766064
complement(1962)-t, cdbSNP:144062651
complement(2000)-dbSNP:
complement(2000)-g, adbSNP:370892022
complement(2001)-t, cdbSNP:149518219
complement(2066)-g, adbSNP:192905881
complement(2101)-g, adbSNP:138079613
complement(2158)-c, adbSNP:368664984
complement(2223)-t, cdbSNP:150809651
complement(2242)-g, cdbSNP:200171609
complement(2251..2252)-, aadbSNP:111643910
complement(2253)-g, adbSNP:3747563
complement(2256..2257)-, ggdbSNP:112291115
complement(2256)-g, adbSNP:3747562
complement(2273)-t, cdbSNP:139937830
complement(2276)-g, cdbSNP:374621616
complement(2296)-g, cdbSNP:370129051
complement(2329)-g, adbSNP:376257338
complement(2332)-t, cdbSNP:143947284
complement(2346)-t, cdbSNP:373302710
complement(2351)-t, cdbSNP:370547490
complement(2381)-t, cdbSNP:377294908
complement(2399)-t, cdbSNP:189093086
complement(2418)-g, adbSNP:199893979
complement(2425)-t, cdbSNP:149496604
complement(2459)-t, cdbSNP:369790443
complement(2470)-g, adbSNP:377228096
complement(2472)-g, adbSNP:374657704
complement(2473)-t, cdbSNP:369077719
complement(2476)-t, cdbSNP:371991440
complement(2547)-g, adbSNP:137985321
complement(2548)-t, cdbSNP:150287042
complement(2570)-g, adbSNP:138452760
complement(2576)-t, cdbSNP:375420597
complement(2578)-t, cdbSNP:370967125
complement(2590)-g, adbSNP:3827522
complement(2619)-g, adbSNP:148989635
complement(2623)-t, cdbSNP:145860632
complement(2637)-g, adbSNP:149852787
complement(2658)-g, cdbSNP:35854729
complement(2665)-c, adbSNP:146670726
complement(2670)-t, cdbSNP:143240342
complement(2690)-g, adbSNP:374409698
complement(2717)-g, adbSNP:200984524
complement(2724)-t, cdbSNP:375310663
complement(2734)-g, adbSNP:201705679
complement(2754)-t, adbSNP:139855191
complement(2758)-g, adbSNP:150545495
complement(2760)-t, cdbSNP:377290931
complement(2779)-g, cdbSNP:142613488
complement(2793)-t, cdbSNP:138524511
complement(2841)-g, adbSNP:376858650
complement(2885)-t, cdbSNP:200644857
complement(2895)-g, cdbSNP:372633476
complement(2896)-t, cdbSNP:147122337
complement(2941)-g, adbSNP:1043652
complement(2953)-, adbSNP:151151770
complement(3059)-t, cdbSNP:192612214
3111+c, tdbSNP:1043656
complement(3248)-c, adbSNP:17091220
complement(3280)-g, cdbSNP:141738298
complement(3333)-t, gdbSNP:187632148
3377+g, tdbSNP:12658
complement(3392..3393)-, ttdbSNP:76259006
complement(3392)-, tdbSNP:398019285
complement(3402)-, tdbSNP:68074167
complement(3565)-c, adbSNP:147942021
complement(3747)-t, cdbSNP:368596743
complement(3833)-t, gdbSNP:73126459
complement(3884..3885)-, adbSNP:371922303
complement(3885)-, adbSNP:201368761
complement(3897)-g, adbSNP:11181513
complement(3921)-t, cdbSNP:182902189
complement(4020)-g, adbSNP:192161217
complement(4124..4138)-, acttacagtactcaadbSNP:376939377
complement(4133)-c, adbSNP:1669933
complement(4244)-t, cdbSNP:1051453
4300+a, cdbSNP:3168685
Gene SymbolPRICKLE1
Gene SynonymEPM1B; RILP
Chromosome12
Locus Map12q12
Title Mink1 regulates beta-catenin-independent Wnt signaling via Prickle phosphorylation .
Author Daulat AM, Luu O, Sing A, Zhang L, Wrana JL, McNeill H, Winklbauer
Journal Mol. Cell. Biol. 32 (1), 173-185 (2012)
Title Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women .
Author Fox CS, Liu Y, White CC, Feitosa M, Smith AV, Heard-Costa N, Lohman K, Johnson AD, Foster MC, Greenawalt DM, Griffin P, Ding J, Newman AB, Tylavsky F, Miljkovic I, Kritchevsky SB, Launer L, Garcia M, Eiriksdottir G, Carr JJ, Gudnason V, Harris TB, Cupples LA and Borecki IB.
Journal PLoS Genet. 8 (5), E1002695 (2012)
Title Identification and characterization of novel rare mutations in the planar cell polarity gene PRICKLE1 in human neural tube defects .
Author Bosoi CM, Capra V, Allache R, Trinh VQ, De Marco P, Merello E, Drapeau P, Bassuk AG and Kibar Z.
Journal Hum. Mutat. 32 (12), 1371-1375 (2011)
Title Mutations in prickle orthologs cause seizures in flies, mice, and humans .
Author Tao H, Manak JR, Sowers L, Mei X, Kiyonari H, Abe T, Dahdaleh NS, Yang T, Wu S, Chen S, Fox MH, Gurnett C, Montine T, Bird T, Shaffer LG, Rosenfeld JA, McConnell J, Madan-Khetarpal S, Berry-Kravis E, Griesbach H, Saneto RP, Scott MP, Antic D, Reed J, Boland R, Ehaideb SN, El-Shanti H, Mahajan VB, Ferguson PJ, Axelrod JD, Lehesjoki AE, Fritzsch B, Slusarski DC, Wemmie J, Ueno N and Bassuk AG.
Journal Am. J. Hum. Genet. 88 (2), 138-149 (2011)
Title Prickle-1 negatively regulates Wnt/beta-catenin pathway by promoting Dishevelled ubiquitination/degradation in liver cancer .
Author Chan DW, Chan CY, Yam JW, Ching YP and Ng IO.
Journal Gastroenterology 131 (4), 1218-1227 (2006)
Title Regulation of human tyrosine hydroxylase gene by neuron-restrictive silencer factor .
Author Kim SM, Yang JW, Park MJ, Lee JK, Kim SU, Lee YS and Lee MA.
Journal Biochem. Biophys. Res. Commun. 346 (2), 426-435 (2006)
Title Characterization of the REST/NRSF-interacting LIM domain protein (RILP): localization and interaction with REST/NRSF .
Author Shimojo M and Hersh LB.
Journal J. Neurochem. 96 (4), 1130-1138 (2006)
Title REST/NRSF-interacting LIM domain protein, a putative nuclear translocation receptor .
Author Shimojo M and Hersh LB.
Journal Mol. Cell. Biol. 23 (24), 9025-9031 (2003)
Title Identification and characterization of human PRICKLE1 and PRICKLE2 genes as well as mouse Prickle1 and Prickle2 genes homologous to Drosophila tissue polarity gene prickle .
Author Katoh M and Katoh M.
Journal Int. J. Mol. Med. 11 (2), 249-256 (2003)
Title PRICKLE1-Related Progressive Myoclonus Epilepsy with Ataxia .
Author Fox,M.H. and Bassuk,A.G.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.