• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens POU domain class 5, transcription factor 2 (POU5F2), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_153216 Homo sapiens POU domain class 5, transcription factor 2 (POU5F2), mRNA. GenEZ ORF Cloning On-demand $549.00 14

*Business Day

Related Services

RefSeq Version NM_153216.1, 23463325
Length 1295 bp
Structure linear
Update Date 24-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens POU domain class 5, transcription factor 2 (POU5F2), mRNA.
Product POU domain, class 5, transcription factor 2
Comment

COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AK098546.1.


##Evidence-Data-START## Transcript exon combination :: AK098546.1 [ECO:0000332] ##Evidence-Data-END##

RefSeq NP_694948.1
CDS 41..1027
Misc Feature(1)407..616
Misc Feature(2)407..616
Misc Feature(3)671..823
Misc Feature(4)order(671..685,689..691,740..742,758..760,797..799,
Misc Feature(5)order(677..679,686..688,806..808,815..820)
Exon (1)1..1295
Gene:POU5F2
Gene Synonym:SPRM-1
Translation MAGHRPSNHFCPLPGSGGGGPRGPMPLRVDTLTWLSTQAAPGRVMVWPAVRPGICPGPDV WRIPLGPLPHEFRGWIAPCRPRLGASEAGDWLRRPSEGALPGPYIALRSIPKLPPPEDIS GILKELQQLAKELRQKRLSLGYSQADVGIAVGALFGKVLSQTTICRFEAQQLSVANMWKL RPLLKKWLKEVEAENLLGLCKMEMILQQSGKWRRASRERRIGNSLEKFFQRCPKPTPQQI SHIAGCLQLQKDVVRVWFYNRSKMGSRPTNDASPREIVGTAGPPCPGAPVCFHLGLGLPV DIPHYTRLYSAGVAHSSAPATTLGLLRF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(20)-dbSNP:
complement(20)-t, cdbSNP:112317301
complement(168)-t, cdbSNP:181777565
complement(217)-g, adbSNP:138308146
complement(295)-g, adbSNP:111528856
complement(334)-g, adbSNP:190094264
complement(400)-t, cdbSNP:147041924
complement(517)-g, adbSNP:142976192
complement(526)-t, cdbSNP:185367860
complement(578)-g, cdbSNP:200489758
complement(703)-g, adbSNP:199511635
Gene SymbolPOU5F2
Gene SynonymSPRM-1
Chromosome5
Locus Map5q15
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_153216 Homo sapiens POU domain class 5, transcription factor 2 (POU5F2), mRNA. On-demand $549.00 14
Title A human POU domain gene, mPOU, is expressed in developing brain and specific adult tissues .
Author Wey,E., Lyons,G.E. and Schafer,B.W.
Journal Eur. J. Biochem. 220 (3), 753-762 (1994)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.