Homo sapiens POU domain class 5, transcription factor 2 (POU5F2), mRNA.
| RefSeq Version | NM_153216.1, 23463325 |
| Length | 1295 bp |
| Structure | linear |
| Update Date | 10-NOV-2010 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens POU domain class 5, transcription factor 2 (POU5F2), mRNA. |
| Product | POU domain, class 5, transcription factor 2 |
| Comment | COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AK098546.1. |
| RefSeq | NP_694948.1 |
| CDS | 41..1027 | Exon (1) | 1..1295 | Exon (2) | 1..1295 |
| Translation | MAGHRPSNHFCPLPGSGGGGPRGPMPLRVDTLTWLSTQAAPGRVMVWPAVRPGICPGPDV
WRIPLGPLPHEFRGWIAPCRPRLGASEAGDWLRRPSEGALPGPYIALRSIPKLPPPEDIS
GILKELQQLAKELRQKRLSLGYSQADVGIAVGALFGKVLSQTTICRFEAQQLSVANMWKL
RPLLKKWLKEVEAENLLGLCKMEMILQQSGKWRRASRERRIGNSLEKFFQRCPKPTPQQI
SHIAGCLQLQKDVVRVWFYNRSKMGSRPTNDASPREIVGTAGPPCPGAPVCFHLGLGLPV
DIPHYTRLYSAGVAHSSAPATTLGLLRF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(20) | - | t, c | dbSNP:112317301 |
| complement(58) | - | g, a | dbSNP:79466683 |
| complement(295) | - | g, a | dbSNP:111528856 |
| Gene Symbol | POU5F2 |
| Gene Synonym | DKFZp686P02123; FLJ25680; SPRM-1 |
| Chromosome | 5 |
| Locus Map | 5q15 |
| All Transcripts | NM_153216 |
| Title | A human POU domain gene, mPOU, is expressed in developing brain and specific adult tissues . |
| Author | Wey,E., Lyons,G.E. and Schafer,B.W. |
| Journal | Eur. J. Biochem. 220 (3), 753-762 (1994) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |