• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens POU domain class 5, transcription factor 2 (POU5F2), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_153216 Homo sapiens POU domain class 5, transcription factor 2 (POU5F2), mRNA. GenEZ ORF Cloning On-demand $549.00 14

*Business Day

Related Services

RefSeq Version NM_153216.1, 23463325
Length 1295 bp
Structure linear
Update Date 01-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens POU domain class 5, transcription factor 2 (POU5F2), mRNA.
Product POU domain, class 5, transcription factor 2
Comment

COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AK098546.1.


##Evidence-Data-START## Transcript exon combination :: AK098546.1 [ECO:0000332] ##Evidence-Data-END##

RefSeq NP_694948.1
CDS 41..1027
Misc Feature(1)407..616
Misc Feature(2)407..616
Misc Feature(3)<713..823
Misc Feature(4)order(806..808,815..820)
Exon (1)1..1295
Gene:POU5F2
Gene Synonym:SPRM-1
Translation MAGHRPSNHFCPLPGSGGGGPRGPMPLRVDTLTWLSTQAAPGRVMVWPAVRPGICPGPDV WRIPLGPLPHEFRGWIAPCRPRLGASEAGDWLRRPSEGALPGPYIALRSIPKLPPPEDIS GILKELQQLAKELRQKRLSLGYSQADVGIAVGALFGKVLSQTTICRFEAQQLSVANMWKL RPLLKKWLKEVEAENLLGLCKMEMILQQSGKWRRASRERRIGNSLEKFFQRCPKPTPQQI SHIAGCLQLQKDVVRVWFYNRSKMGSRPTNDASPREIVGTAGPPCPGAPVCFHLGLGLPV DIPHYTRLYSAGVAHSSAPATTLGLLRF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(19)-dbSNP:
complement(19)-t, gdbSNP:375465714
complement(20)-t, cdbSNP:112317301
complement(43)-t, cdbSNP:370809672
complement(63)-t, cdbSNP:373831731
complement(76)-g, cdbSNP:372798416
complement(100)-g, adbSNP:369781509
complement(148)-g, adbSNP:376581154
complement(157)-t, cdbSNP:371634969
complement(168)-t, cdbSNP:181777565
complement(187)-t, adbSNP:372897251
complement(194)-g, adbSNP:368188217
complement(199)-c, adbSNP:374687071
complement(209)-g, cdbSNP:372081385
complement(217)-g, adbSNP:138308146
complement(295)-g, adbSNP:111528856
complement(328)-g, adbSNP:374189353
complement(334)-g, adbSNP:190094264
complement(344)-t, cdbSNP:371062975
complement(385)-c, adbSNP:376341807
complement(395)-t, cdbSNP:373841980
complement(400)-t, cdbSNP:147041924
complement(429)-g, adbSNP:376579858
complement(461)-c, adbSNP:373405434
complement(485)-t, cdbSNP:369187302
complement(517)-g, adbSNP:142976192
complement(526)-t, cdbSNP:185367860
complement(570)-c, adbSNP:373989380
complement(578)-g, cdbSNP:200489758
complement(664)-c, adbSNP:377225323
complement(703)-g, adbSNP:199511635
complement(732)-t, cdbSNP:371786597
complement(781)-g, adbSNP:369080417
complement(804)-t, cdbSNP:374849047
complement(821)-g, adbSNP:267600735
complement(840)-t, cdbSNP:372162822
complement(883)-g, cdbSNP:367941888
complement(948)-g, cdbSNP:374302489
complement(1098)-t, gdbSNP:374928860
Gene SymbolPOU5F2
Gene SynonymSPRM-1
Chromosome5
Locus Map5q15
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_153216 Homo sapiens POU domain class 5, transcription factor 2 (POU5F2), mRNA. On-demand $549.00 14
Title A human POU domain gene, mPOU, is expressed in developing brain and specific adult tissues .
Author Wey E, Lyons GE and Schafer BW.
Journal Eur. J. Biochem. 220 (3), 753-762 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.