• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens G protein-coupled receptor 114 (GPR114), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_153837 Homo sapiens G protein-coupled receptor 114 (GPR114), mRNA. GenEZ ORF Cloning On-demand $699.00 18

*Business Day

Related Services

RefSeq Version NM_153837.1, 24475870
Length 3848 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens G protein-coupled receptor 114 (GPR114), mRNA.
Product probable G-protein coupled receptor 114 precursor
Comment

COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC032401.1.


##Evidence-Data-START## Transcript exon combination :: BC032401.1, AK128298.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025089 [ECO:0000348] ##Evidence-Data-END##

RefSeq NP_722579.1
CDS 524..2110
Misc Feature(1)389..391
Misc Feature(2)1076..1222
Misc Feature(3)1268..>1624
Misc Feature(4)1274..1336
Misc Feature(5)1394..1456
Misc Feature(6)1493..1555
Misc Feature(7)1583..1645
Misc Feature(8)1763..1825
Misc Feature(9)1892..1960
Misc Feature(10)1970..2038
Exon (1)1..485
Gene:GPR114
Gene Synonym:PGR27
Exon (2)486..587
Gene:GPR114
Gene Synonym:PGR27
Exon (3)588..663
Gene:GPR114
Gene Synonym:PGR27
Exon (4)664..820
Gene:GPR114
Gene Synonym:PGR27
Exon (5)821..952
Gene:GPR114
Gene Synonym:PGR27
Exon (6)953..1069
Gene:GPR114
Gene Synonym:PGR27
Exon (7)1070..1222
Gene:GPR114
Gene Synonym:PGR27
Exon (8)1223..1344
Gene:GPR114
Gene Synonym:PGR27
Exon (9)1345..1613
Gene:GPR114
Gene Synonym:PGR27
Exon (10)1614..1731
Gene:GPR114
Gene Synonym:PGR27
Exon (11)1732..2009
Gene:GPR114
Gene Synonym:PGR27
Exon (12)2010..3761
Gene:GPR114
Gene Synonym:PGR27
Translation MDHCGALFLCLCLLTLQNATTETWEELLSYMENMQVSRGRSSVFSSRQLHQLEQMLLNTS FPGYNLTLQTPTIQSLAFKLSCDFSGLSLTSATLKRVPQAGGQHARGQHAMQFPAELTRD ACKTRPRELRLICIYFSNTHFFKDENNSSLLNNYVLGAQLSHGHVNNLRDPVNISFWHNQ SLEGYTLTCVFWKEGARKQPWGGWSPEGCRTEQPSHSQVLCRCNHLTYFAVLMQLSPALV PAELLAPLTYISLVGCSISIVASLITVLLHFHFRKQSDSLTRIHMNLHASVLLLNIAFLL SPAFAMSPVPGSACTALAAALHYALLSCLTWMAIEGFNLYLLLGRVYNIYIRRYVFKLGV LGWGAPALLVLLSLSVKSSVYGPCTIPVFDSWENGTGFQNMSICWVRSPVVHSVLVMGYG GLTSLFNLVVLAWALWTLRRLRERADAPSVRACHDTVTVLGLTVLLGTTWALAFFSFGVF LLPQLFLFTILNSLYGFFLFLWFCSQRCRSEAEAKAQIEAFSSSQTTQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
115+dbSNP:
115+g, tdbSNP:1985493
120+a, gdbSNP:2006254
191+a, gdbSNP:141993239
510+dbSNP:
510+a, gdbSNP:202192910
517+a, gdbSNP:1004363
535+g, tdbSNP:201729290
576+a, cdbSNP:141637452
581+a, gdbSNP:115266147
592+dbSNP:
592+a, gdbSNP:149325720
610+c, gdbSNP:115132653
614+a, tdbSNP:114089767
624+c, tdbSNP:115236760
663+a, gdbSNP:143672048
670+dbSNP:
670+c, gdbSNP:201319215
752+a, gdbSNP:147162768
787+a, gdbSNP:114907317
808+g, tdbSNP:111324660
809+c, gdbSNP:150723116
821+dbSNP:
821+a, gdbSNP:139389524
900+c, tdbSNP:150062848
924+c, tdbSNP:200552943
943..944+, tdbSNP:35837636
954+dbSNP:
954+a, gdbSNP:146649312
985+c, tdbSNP:78040384
986+a, gdbSNP:143828233
1015+a, cdbSNP:146807848
1083+dbSNP:
1083+c, tdbSNP:201048573
1125+c, gdbSNP:201845314
1127+c, gdbSNP:200838029
1130+c, gdbSNP:140617670
1151+c, tdbSNP:201524707
1163+c, gdbSNP:143632938
1188+a, g, tdbSNP:115753984
1228+dbSNP:
1228+c, gdbSNP:116286411
1232+c, tdbSNP:140960910
1250+g, tdbSNP:150374452
1270+a, gdbSNP:138227846
1282+c, tdbSNP:200800828
1367+dbSNP:
1367+c, tdbSNP:116445849
1369+c, tdbSNP:9937918
1371+c, tdbSNP:114187078
1376+a, gdbSNP:71387175
1381+c, tdbSNP:146006750
1408+a, cdbSNP:138704401
1421+c, gdbSNP:115719809
1432+a, gdbSNP:144418743
1439+a, tdbSNP:147980919
1440+c, tdbSNP:141647621
1467+c, tdbSNP:114139150
1468+a, gdbSNP:115877955
1477+c, tdbSNP:201435952
1482+c, tdbSNP:140192551
1494+c, tdbSNP:143764238
1512+c, tdbSNP:146366530
1523+a, gdbSNP:200238795
1525+a, cdbSNP:139279864
1556+c, tdbSNP:201549132
1559+c, gdbSNP:140917718
1577+c, tdbSNP:192608331
1578+a, gdbSNP:74019570
1627+dbSNP:
1627+c, tdbSNP:149134796
1660+a, gdbSNP:144648370
1684+c, tdbSNP:199749007
1685+a, gdbSNP:200866735
1709+a, gdbSNP:201892010
1713+c, gdbSNP:147634705
1743+dbSNP:
1743+a, gdbSNP:142292696
1750+c, tdbSNP:145913178
1758+a, gdbSNP:138832095
1779+a, gdbSNP:182873909
1784+a, gdbSNP:201829651
1792+a, gdbSNP:140347967
1802+a, gdbSNP:150321395
1823+g, tdbSNP:200746223
1854+a, gdbSNP:137996759
1857+c, tdbSNP:149449822
1892+a, gdbSNP:114200545
1915+a, gdbSNP:114796383
1960+c, tdbSNP:7196203
2001+c, tdbSNP:114811370
2002+a, gdbSNP:116598559
2005+c, gdbSNP:16957788
2009+c, gdbSNP:146406891
2029+dbSNP:
2029+a, gdbSNP:148556945
2048+c, tdbSNP:62036095
2052+c, tdbSNP:150635750
2088+c, gdbSNP:139802420
2112+a, cdbSNP:144586283
2116+g, tdbSNP:187483286
2250+c, tdbSNP:138976473
2281+a, gdbSNP:118127254
2284+c, tdbSNP:6499885
2371..2372+, gdbSNP:34338440
2438+c, tdbSNP:113144211
2447+c, tdbSNP:113791878
2499+c, gdbSNP:148890281
2507+a, gdbSNP:16957796
2552+a, gdbSNP:7189944
2556+, adbSNP:113523289
2732+c, tdbSNP:143554501
2822+a, gdbSNP:189062180
2827+c, tdbSNP:148024275
2904+g, tdbSNP:80157257
3038+a, gdbSNP:141725230
3082+a, tdbSNP:146343808
3083+c, tdbSNP:12934339
3112..3113+, tcdbSNP:150724509
3112+, tcdbSNP:10547185
3186+a, gdbSNP:116526474
3305+c, tdbSNP:193018656
3337+c, tdbSNP:138310101
3408+a, cdbSNP:13333179
3442+c, tdbSNP:75469960
3443+a, gdbSNP:2279874
3456+a, gdbSNP:10802
3486+a, gdbSNP:115449369
3492+a, cdbSNP:2279875
3567+g, tdbSNP:74675768
3595+a, gdbSNP:112942947
3683+a, gdbSNP:2279876
3695+c, tdbSNP:188180514
Gene SymbolGPR114
Gene SynonymPGR27
Chromosome16
Locus Map16q21
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_153837 Homo sapiens G protein-coupled receptor 114 (GPR114), mRNA. On-demand $699.00 18
Title Genome-wide association study of vitamin D concentrations in Hispanic Americans: the IRAS family study .
Author Engelman,C.D., Meyers,K.J., Ziegler,J.T., Taylor,K.D., Palmer,N.D., Haffner,S.M., Fingerlin,T.E., Wagenknecht,L.E., Rotter,J.I., Bowden,D.W., Langefeld,C.D. and Norris,J.M.
Journal J. Steroid Biochem. Mol. Biol. 122 (4), 186-192 (2010)
Title The human and mouse repertoire of the adhesion family of G-protein-coupled receptors .
Author Bjarnadottir,T.K., Fredriksson,R., Hoglund,P.J., Gloriam,D.E., Lagerstrom,M.C. and Schioth,H.B.
Journal Genomics 84 (1), 23-33 (2004)
Title The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment .
Author Clark,H.F., Gurney,A.L., Abaya,E., Baker,K., Baldwin,D., Brush,J., Chen,J., Chow,B., Chui,C., Crowley,C., Currell,B., Deuel,B., Dowd,P., Eaton,D., Foster,J., Grimaldi,C., Gu,Q., Hass,P.E., Heldens,S., Huang,A., Kim,H.S., Klimowski,L., Jin,Y., Johnson,S., Lee,J., Lewis,L., Liao,D., Mark,M., Robbie,E., Sanchez,C., Schoenfeld,J., Seshagiri,S., Simmons,L., Singh,J., Smith,V., Stinson,J., Vagts,A., Vandlen,R., Watanabe,C., Wieand,D., Woods,K., Xie,M.H., Yansura,D., Yi,S., Yu,G., Yuan,J., Zhang,M., Zhang,Z., Goddard,A., Wood,W.I., Godowski,P. and Gray,A.
Journal Genome Res. 13 (10), 2265-2270 (2003)
Title The G protein-coupled receptor repertoires of human and mouse .
Author Vassilatis,D.K., Hohmann,J.G., Zeng,H., Li,F., Ranchalis,J.E., Mortrud,M.T., Brown,A., Rodriguez,S.S., Weller,J.R., Wright,A.C., Bergmann,J.E. and Gaitanaris,G.A.
Journal Proc. Natl. Acad. Sci. U.S.A. 100 (8), 4903-4908 (2003)
Title Novel human G protein-coupled receptors with long N-terminals containing GPS domains and Ser/Thr-rich regions .
Author Fredriksson,R., Lagerstrom,M.C., Hoglund,P.J. and Schioth,H.B.
Journal FEBS Lett. 531 (3), 407-414 (2002)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.