• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens lamin A/C (LMNA), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_170707 Homo sapiens lamin A/C (LMNA), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $639.00 $590.00 15

*Business Day

Related Services

RefSeq Version NM_170707.3, 383792147
Length 3239 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens lamin A/C (LMNA), transcript variant 1, mRNA.
Product lamin isoform A
Comment

Summary: The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Vertebrate lamins consist of two types, A and B. Alternative splicing results in multiple transcript variants. Mutations in this gene lead to several diseases: Emery-Dreifuss muscular dystrophy, familial partial lipodystrophy, limb girdle muscular dystrophy, dilated cardiomyopathy, Charcot-Marie-Tooth disease, and Hutchinson-Gilford progeria syndrome. [provided by RefSeq, Apr 2012].


Transcript Variant: This variant (1) encodes isoform A.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_733821.1
CDS 250..2244
Misc Feature(1)13..15
Misc Feature(2)13..15
Misc Feature(3)250..639
Misc Feature(4)250..348
Misc Feature(5)250..252
Misc Feature(6)256..258
Misc Feature(7)277..279
Misc Feature(8)283..285
Misc Feature(9)301..303
Misc Feature(10)304..306
Misc Feature(11)304..306
Misc Feature(12)304..306
Misc Feature(13)304..306
Misc Feature(14)313..315
Misc Feature(15)313..315
Misc Feature(16)313..315
Misc Feature(17)319..321
Misc Feature(18)337..1383
Misc Feature(19)349..1398
Misc Feature(20)349..459
Misc Feature(21)460..489
Misc Feature(22)490..903
Misc Feature(23)529..531
Misc Feature(24)571..573
Misc Feature(25)883..885
Misc Feature(26)904..975
Misc Feature(27)937..939
Misc Feature(28)937..939
Misc Feature(29)976..1398
Misc Feature(30)1045..1047
Misc Feature(31)1057..1059
Misc Feature(32)1078..1080
Misc Feature(33)1078..1080
Misc Feature(34)1093..1095
Misc Feature(35)1150..1152
Misc Feature(36)1180..1182
Misc Feature(37)1222..1224
Misc Feature(38)1237..1239
Misc Feature(39)1399..2241
Misc Feature(40)1417..1419
Misc Feature(41)1417..1419
Misc Feature(42)1417..1419
Misc Feature(43)1423..1425
Misc Feature(44)1423..1425
Misc Feature(45)1423..1425
Misc Feature(46)1423..1425
Misc Feature(47)1429..1431
Misc Feature(48)1432..1434
Misc Feature(49)1432..1434
Misc Feature(50)1456..1458
Misc Feature(51)1459..1461
Misc Feature(52)1459..1461
Misc Feature(53)1465..1467
Misc Feature(54)1468..1470
Misc Feature(55)1474..1476
Misc Feature(56)1489..1491
Misc Feature(57)1489..1491
Misc Feature(58)1495..1497
Misc Feature(59)1498..1515
Misc Feature(60)1516..1518
Misc Feature(61)1519..1521
Misc Feature(62)1525..1527
Misc Feature(63)1540..1542
Misc Feature(64)1543..1872
Misc Feature(65)1597..1599
Misc Feature(66)1621..1623
Misc Feature(67)1636..1638
Misc Feature(68)1762..1764
Misc Feature(69)1822..1824
Misc Feature(70)2083..2085
Misc Feature(71)2086..2088
Misc Feature(72)2095..2097
Misc Feature(73)2101..2103
Misc Feature(74)2104..2106
Misc Feature(75)2131..2133
Misc Feature(76)2131..2133
Misc Feature(77)2143..2145
Misc Feature(78)2143..2145
Misc Feature(79)2155..2157
Misc Feature(80)2155..2157
Misc Feature(81)2176..2178
Misc Feature(82)2185..2190
Misc Feature(83)2185..2187
Misc Feature(84)2203..2205
Misc Feature(85)2203..2205
Misc Feature(86)2203..2205
Misc Feature(87)2230..2232
Exon (1)1..605
Gene:LMNA
Gene Synonym:CDCD1; CDDC; CMD1A; CMT2B1; EMD2; FPL; FPLD; FPLD2; HGPS; IDC; LDP1; LFP; LGMD1B; LMN1; LMNC; LMNL1; PRO1
Exon (2)606..762
Gene:LMNA
Gene Synonym:CDCD1; CDDC; CMD1A; CMT2B1; EMD2; FPL; FPLD; FPLD2; HGPS; IDC; LDP1; LFP; LGMD1B; LMN1; LMNC; LMNL1; PRO1
Exon (3)763..888
Gene:LMNA
Gene Synonym:CDCD1; CDDC; CMD1A; CMT2B1; EMD2; FPL; FPLD; FPLD2; HGPS; IDC; LDP1; LFP; LGMD1B; LMN1; LMNC; LMNL1; PRO1
Exon (4)889..1059
Gene:LMNA
Gene Synonym:CDCD1; CDDC; CMD1A; CMT2B1; EMD2; FPL; FPLD; FPLD2; HGPS; IDC; LDP1; LFP; LGMD1B; LMN1; LMNC; LMNL1; PRO1
Exon (5)1060..1185
Gene:LMNA
Gene Synonym:CDCD1; CDDC; CMD1A; CMT2B1; EMD2; FPL; FPLD; FPLD2; HGPS; IDC; LDP1; LFP; LGMD1B; LMN1; LMNC; LMNL1; PRO1
Exon (6)1186..1406
Gene:LMNA
Gene Synonym:CDCD1; CDDC; CMD1A; CMT2B1; EMD2; FPL; FPLD; FPLD2; HGPS; IDC; LDP1; LFP; LGMD1B; LMN1; LMNC; LMNL1; PRO1
Exon (7)1407..1629
Gene:LMNA
Gene Synonym:CDCD1; CDDC; CMD1A; CMT2B1; EMD2; FPL; FPLD; FPLD2; HGPS; IDC; LDP1; LFP; LGMD1B; LMN1; LMNC; LMNL1; PRO1
Exon (8)1630..1737
Gene:LMNA
Gene Synonym:CDCD1; CDDC; CMD1A; CMT2B1; EMD2; FPL; FPLD; FPLD2; HGPS; IDC; LDP1; LFP; LGMD1B; LMN1; LMNC; LMNL1; PRO1
Exon (9)1738..1857
Gene:LMNA
Gene Synonym:CDCD1; CDDC; CMD1A; CMT2B1; EMD2; FPL; FPLD; FPLD2; HGPS; IDC; LDP1; LFP; LGMD1B; LMN1; LMNC; LMNL1; PRO1
Exon (10)1858..1947
Gene:LMNA
Gene Synonym:CDCD1; CDDC; CMD1A; CMT2B1; EMD2; FPL; FPLD; FPLD2; HGPS; IDC; LDP1; LFP; LGMD1B; LMN1; LMNC; LMNL1; PRO1
Exon (11)1948..2217
Gene:LMNA
Gene Synonym:CDCD1; CDDC; CMD1A; CMT2B1; EMD2; FPL; FPLD; FPLD2; HGPS; IDC; LDP1; LFP; LGMD1B; LMN1; LMNC; LMNL1; PRO1
Exon (12)2218..3227
Gene:LMNA
Gene Synonym:CDCD1; CDDC; CMD1A; CMT2B1; EMD2; FPL; FPLD; FPLD2; HGPS; IDC; LDP1; LFP; LGMD1B; LMN1; LMNC; LMNL1; PRO1
Translation METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLR LRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARN TKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAK KQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESR LADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRID SLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQ ELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRK LESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLT YRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAM RKLVRSVTVVEDDEDEDGDDLLHHHHGSHCSSSGDPAEYNLRSRTVLCGTCGQPADKASA SGSGAQVGGPISSGSSASSVTVTRSYRSVGGSGGGSFGDNLVTRSYLLGNSSPRTQSPQN CSIM
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
27+c, tdbSNP:188625872
122+c, tdbSNP:80356803
162+g, tdbSNP:115800510
247..261+, gccatggagaccccgdbSNP:267607546
254+a, gdbSNP:11549669
260+c, gdbSNP:267607620
265+c, tdbSNP:61046466
277..278+, adbSNP:58727209
278+c, tdbSNP:57077886
280+, cdbSNP:60029152
300+c, tdbSNP:11549668
322+c, g, tdbSNP:58327533
323+c, gdbSNP:61578124
324+c, tdbSNP:80356804
331+c, tdbSNP:59914820
343..345+, aagdbSNP:60872029
347+a, gdbSNP:267607614
348+c, g, tdbSNP:57966821
352+c, gdbSNP:56694480
353+c, tdbSNP:267607644
355+c, tdbSNP:267607601
364+a, tdbSNP:267607627
365+a, gdbSNP:57983345
376+a, gdbSNP:60446065
383+a, gdbSNP:58436778
385+a, gdbSNP:267607615
388+c, gdbSNP:267607608
397+a, cdbSNP:59931416
398+c, gdbSNP:60695352
404+c, tdbSNP:267607611
407+a, tdbSNP:60290646
418+c, gdbSNP:28928903
425+g, tdbSNP:58922911
427+c, gdbSNP:28928900
433+c, gdbSNP:56793579
437+a, g, tdbSNP:57793737
441+c, tdbSNP:137969290
452..457+, aggtggdbSNP:267607586
463+c, gdbSNP:17847247
493+a, gdbSNP:59270054
503+g, tdbSNP:28933090
514+c, tdbSNP:267607559
515+g, tdbSNP:59040894
523+c, tdbSNP:267607560
538+a, gdbSNP:59065411
551+c, gdbSNP:267607568
580+g, tdbSNP:61726475
583..585+, gagdbSNP:61726474
597..598+, gdbSNP:267607646
604+c, tdbSNP:17856971
606+dbSNP:
606+c, tdbSNP:41313880
622+a, gdbSNP:267607605
643+c, gdbSNP:61726478
647+c, g, tdbSNP:60864230
655+c, gdbSNP:267607619
661+a, gdbSNP:267607649
668+c, g, tdbSNP:60652225
676+c, tdbSNP:61661343
677+c, tdbSNP:58912633
682+a, gdbSNP:60310264
687+c, tdbSNP:80356805
688+a, gdbSNP:139875047
697+a, cdbSNP:58917027
720+a, gdbSNP:150645079
724+a, gdbSNP:267607622
730+a, gdbSNP:28933093
734+c, tdbSNP:267607594
746+c, gdbSNP:267607570
755+, tdbSNP:267607595
762+a, gdbSNP:267607542
775+dbSNP:
775+c, tdbSNP:149113760
797+c, tdbSNP:267607583
805+a, gdbSNP:61726479
814+c, tdbSNP:267607626
815..816+cc, ggdbSNP:267607643
817+c, tdbSNP:59026483
818+a, gdbSNP:267607571
819..820+, cggdbSNP:267607628
824+a, g, tdbSNP:57045855
834+a, c, gdbSNP:28933091
837..845+, gctgcagacdbSNP:267607541
856+a, gdbSNP:61195471
857+a, g, tdbSNP:28933092
861+a, gdbSNP:12117552
867+c, gdbSNP:267607629
871..873+, aagdbSNP:267607540
873..875+, gaadbSNP:267607551
874+, adbSNP:62636507
878+g, tdbSNP:267607572
893+dbSNP:
893+c, tdbSNP:61295588
894+g, tdbSNP:80356808
905+a, cdbSNP:267607584
913+c, tdbSNP:28928901
914+a, cdbSNP:58034145
922+c, tdbSNP:60682848
923+a, gdbSNP:199474724
937+a, gdbSNP:61214927
940+a, cdbSNP:11549666
943+c, gdbSNP:267607609
944+a, gdbSNP:57207746
949+c, tdbSNP:267607573
952+c, tdbSNP:201227908
972+a, gdbSNP:58235810
979+a, gdbSNP:201866557
985+c, tdbSNP:267607587
992+c, tdbSNP:58850446
994+c, tdbSNP:121912496
995+a, gdbSNP:59332535
998..999+, cdbSNP:34777960
1024+c, g, tdbSNP:60578328
1026+a, tdbSNP:58048078
1030..1032+, aagdbSNP:58978449
1037+c, tdbSNP:267607625
1038+a, gdbSNP:148557956
1048+c, tdbSNP:267607593
1049+a, gdbSNP:57048196
1051+c, tdbSNP:267607630
1059+a, gdbSNP:267607631
1061+dbSNP:
1061+c, tdbSNP:267607641
1064..1067+acaa, ccagacdbSNP:267607616
1104+, gdbSNP:59564495
complement(1110)-g, adbSNP:538089
1113..1116+, ccacdbSNP:60168366
1130+a, cdbSNP:61616775
1132+c, tdbSNP:267607633
1141+c, tdbSNP:59885338
1144+a, gdbSNP:150924946
1145+c, tdbSNP:267607684
1147+a, gdbSNP:267607591
1148+g, tdbSNP:79907212
1154+c, tdbSNP:267607596
1156+c, tdbSNP:61527854
1157..1158+, ctdbSNP:59684335
1198+dbSNP:
1198+a, gdbSNP:56816490
1201+a, gdbSNP:267607574
1207+c, tdbSNP:3209921
1208+, tdbSNP:56771886
1210+c, tdbSNP:267607554
1225+a, tdbSNP:56851164
1239+a, gdbSNP:140800215
1241+c, gdbSNP:59301204
1253+a, gdbSNP:138592977
1256+a, gdbSNP:58105277
1266+a, gdbSNP:17847242
1271+a, cdbSNP:11549667
1277+a, gdbSNP:61177390
1288+a, gdbSNP:267607548
1294+c, tdbSNP:267607555
1295+g, tdbSNP:58789393
1296+a, gdbSNP:147015659
1297+c, gdbSNP:267607610
1306+a, cdbSNP:267607623
1312+c, tdbSNP:267607617
1313..1315+, agcdbSNP:267607635
1318+c, gdbSNP:267607567
1321+a, g, tdbSNP:60458016
1330+a, gdbSNP:267607634
1334+, tdbSNP:58389804
1347+a, gdbSNP:57901307
1361+a, tdbSNP:59653062
1363+, gdbSNP:267607575
1371+c, tdbSNP:143715750
1379..1380+, gccctggacatggagatccacgcctaccgdbSNP:267607624
1379+a, g, tdbSNP:61672878
1388+c, tdbSNP:121912495
1391+a, cdbSNP:267607558
1395+c, tdbSNP:57508089
1398+a, gdbSNP:267607603
1406+a, g, tdbSNP:267607545
1408+dbSNP:
1408+c, gdbSNP:267607562
1411+c, tdbSNP:58133342
1412+a, gdbSNP:267607576
1433+c, tdbSNP:267607561
1436+a, gdbSNP:61693978
1444+c, tdbSNP:58672172
1445+a, gdbSNP:267607563
1450+c, tdbSNP:61094188
1451+a, gdbSNP:141490569
1481+a, gdbSNP:267607647
1491+c, tdbSNP:184946451
1492+a, gdbSNP:267607606
1511+c, tdbSNP:267607564
1543+c, tdbSNP:267607618
1548+c, tdbSNP:61217436
1552+c, tdbSNP:150840924
1556..1557+, gcacdbSNP:267607577
1564+c, tdbSNP:62636506
1567+a, gdbSNP:121912493
1572+a, cdbSNP:140194535
1586+a, tdbSNP:58541611
complement(1587)-g, adbSNP:505058
1595+a, gdbSNP:267607637
1606+c, tdbSNP:58932704
1607+c, gdbSNP:267607598
1610+c, tdbSNP:267607638
1611+a, gdbSNP:151160622
1613+c, gdbSNP:267607597
1615+a, gdbSNP:267607599
1616+a, tdbSNP:60992550
1617..1619+, caadbSNP:267607550
1617+a, cdbSNP:61235244
1619+, adbSNP:267607549
1630+dbSNP:
1630+g, tdbSNP:267607642
1639+a, gdbSNP:200262654
1643+a, gdbSNP:61282106
1646+, adbSNP:58100028
1648+c, tdbSNP:267607639
1655+c, tdbSNP:57394692
1660+c, g, tdbSNP:28928902
1661+a, gdbSNP:267607578
1673..1674+, agadbSNP:267607579
1690+c, tdbSNP:57747780
1692+c, gdbSNP:56935051
1693+c, tdbSNP:57920071
1694+a, g, tdbSNP:11575937
1707+c, g, tdbSNP:59981161
1711+a, cdbSNP:267607607
1726+c, tdbSNP:56699480
1736+c, tdbSNP:200466188
1741+dbSNP:
1741+a, tdbSNP:267607585
1742+, gdbSNP:60556110
1743+g, tdbSNP:57730570
1745+, cdbSNP:267607580
1761..1762+, agdbSNP:267607553
1765+c, gdbSNP:267607565
1775..1776+, cdbSNP:58013325
1779+c, tdbSNP:138098342
1784+c, tdbSNP:57877560
1800+a, gdbSNP:41314035
1807+g, tdbSNP:267607557
1808+c, gdbSNP:58362413
1815+c, tdbSNP:149339264
1816+a, gdbSNP:201583907
1828..1829+, ctgcdbSNP:58571998
1828+c, tdbSNP:57318642
1829+a, c, gdbSNP:57520892
1832+a, c, g, tdbSNP:57629361
1833+a, gdbSNP:80356812
1834+a, gdbSNP:121912494
1835+c, tdbSNP:60580541
1838+c, tdbSNP:60934003
1850+c, gdbSNP:144740174
1868+dbSNP:
1868+c, tdbSNP:267607547
1870+a, c, g, tdbSNP:56984562
1871+a, c, gdbSNP:61444459
1875+c, gdbSNP:56673169
1882+c, tdbSNP:267607613
1883+a, gdbSNP:142191737
1888+a, gdbSNP:201947393
1909+c, gdbSNP:71630616
1911+a, gdbSNP:201936898
1913+a, gdbSNP:141578711
1929+c, tdbSNP:17847249
1947+c, tdbSNP:4641
1967+dbSNP:
1967+c, tdbSNP:60890628
1982+a, tdbSNP:61224243
1994+a, gdbSNP:57830985
1997+c, tdbSNP:59601651
2000+a, gdbSNP:56657623
2010+a, gdbSNP:80356813
2011+c, tdbSNP:267607621
2021+g, tdbSNP:267607556
2038..2039+, adbSNP:34195769
2052+c, tdbSNP:267607604
2053+a, gdbSNP:60662302
2070+a, gdbSNP:59886214
2071+a, gdbSNP:61064130
2073+c, tdbSNP:58596362
2086+c, tdbSNP:147627124
2100+c, tdbSNP:143189394
2117+c, gdbSNP:59267781
2119+c, tdbSNP:140455668
2120+a, g, tdbSNP:13768
2126+a, gdbSNP:138208127
2141+a, gdbSNP:267607648
2153+a, gdbSNP:267607612
2157+c, tdbSNP:80356814
2160+c, tdbSNP:117939448
2161+a, gdbSNP:144851946
2179+a, c, tdbSNP:142000963
2196+c, tdbSNP:3209857
2209+c, tdbSNP:267607544
2213..2214+, gdbSNP:267607566
2271+dbSNP:
2271+a, gdbSNP:267607682
complement(2323)-g, cdbSNP:7339
2374+g, tdbSNP:181732923
2384+g, tdbSNP:80356815
2391+a, tdbSNP:2070754
2436+a, cdbSNP:708605
2442..2443+, a, aa, aaadbSNP:35750865
2442+, adbSNP:200317083
2534+a, gdbSNP:143860978
2585+g, tdbSNP:11549665
2609+c, tdbSNP:74116489
2637+c, tdbSNP:111601180
2693+c, tdbSNP:148620960
2883+a, gdbSNP:185169879
2983+a, gdbSNP:3204564
2991+a, gdbSNP:189656652
3088+c, tdbSNP:144299350
3159+c, tdbSNP:15292
Gene SymbolLMNA
Gene SynonymCDCD1; CDDC; CMD1A; CMT2B1; EMD2; FPL; FPLD; FPLD2; HGPS; IDC; LDP1; LFP; LGMD1B; LMN1; LMNC; LMNL1; PRO1
Chromosome1
Locus Map1q22
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001257374 Homo sapiens lamin A/C (LMNA), transcript variant 4, mRNA. On-demand $849.00 20
NM_005572 Homo sapiens lamin A/C (LMNA), transcript variant 2, mRNA. In-stock $639.00 $590.00 15
NM_170707 Homo sapiens lamin A/C (LMNA), transcript variant 1, mRNA. In-stock $639.00 $590.00 15
NM_170708 Homo sapiens lamin A/C (LMNA), transcript variant 3, mRNA. On-demand $849.00 20
Title Dual specificity phosphatase 4 mediates cardiomyopathy caused by lamin A/C (LMNA) gene mutation .
Author Choi,J.C., Wu,W., Muchir,A., Iwata,S., Homma,S. and Worman,H.J.
Journal J. Biol. Chem. 287 (48), 40513-40524 (2012)
Title Quantitative expression of the mutated lamin A/C gene in patients with cardiolaminopathy .
Author Narula,N., Favalli,V., Tarantino,P., Grasso,M., Pilotto,A., Bellazzi,R., Serio,A., Gambarin,F.I., Charron,P., Meder,B., Pinto,Y., Elliott,P.M., Mogensen,J., Bolognesi,M., Bollati,M. and Arbustini,E.
Journal J. Am. Coll. Cardiol. 60 (19), 1916-1920 (2012)
Title Expression of the Hutchinson-Gilford progeria mutation during osteoblast development results in loss of osteocytes, irregular mineralization, and poor biomechanical properties .
Author Schmidt,E., Nilsson,O., Koskela,A., Tuukkanen,J., Ohlsson,C., Rozell,B. and Eriksson,M.
Journal J. Biol. Chem. 287 (40), 33512-33522 (2012)
Title Sp1 transcription factor interaction with accumulated prelamin a impairs adipose lineage differentiation in human mesenchymal stem cells: essential role of sp1 in the integrity of lipid vesicles .
Author Ruiz de Eguino,G., Infante,A., Schlangen,K., Aransay,A.M., Fullaondo,A., Soriano,M., Garcia-Verdugo,J.M., Martin,A.G. and Rodriguez,C.I.
Journal Stem Cells Transl Med 1 (4), 309-321 (2012)
Title LMNA knock-down affects differentiation and progression of human neuroblastoma cells .
Author Maresca,G., Natoli,M., Nardella,M., Arisi,I., Trisciuoglio,D., Desideri,M., Brandi,R., D'Aguanno,S., Nicotra,M.R., D'Onofrio,M., Urbani,A., Natali,P.G., Del Bufalo,D., Felsani,A. and D'Agnano,I.
Journal PLoS ONE 7 (9), E45513 (2012)
Title Mouse and human hemopoietic cell lines of erythroid lineage express lamins A,B and C .
Author Martelli,A.M., Billi,A.M., Gilmour,R.S., Manzoli,L., Di Primio,R. and Cocco,L.
Journal Biochem. Biophys. Res. Commun. 185 (1), 271-276 (1992)
Title Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin .
Author Dawson,S.J. and White,L.A.
Journal J. Infect. 24 (3), 317-320 (1992)
Title Interaction of human immunodeficiency virus type I Rev protein with nuclear scaffold nucleoside triphosphatase activity .
Author Clawson,G.A., Song,Y.L., Schwartz,A.M., Shukla,R.R., Patel,S.G., Connor,L., Blankenship,L., Hatem,C. and Kumar,A.
Journal Cell Growth Differ. 2 (11), 575-582 (1991)
Title Induction of nuclear lamins A/C in macrophages in in vitro cultures of rat bone marrow precursor cells and human blood monocytes, and in macrophages elicited in vivo by thioglycollate stimulation .
Author Rober,R.A., Gieseler,R.K., Peters,J.H., Weber,K. and Osborn,M.
Journal Exp. Cell Res. 190 (2), 185-194 (1990)
Title Mutations of phosphorylation sites in lamin A that prevent nuclear lamina disassembly in mitosis .
Author Heald,R. and McKeon,F.
Journal Cell 61 (4), 579-589 (1990)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.