• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens lamin A/C (LMNA), transcript variant 1, mRNA.


RefSeq Accession Definition Sequence Price Select
NM_170707 Homo sapiens lamin A/C (LMNA), transcript variant 1, mRNA. Full Lenth $1135.05
ORF Sequence $578.55


RefSeq Version NM_170707.2, 153281093
Length 3243 bp
Structure linear
Update Date 24-APR-2011
Organism Homo sapiens (human)
Definition Homo sapiens lamin A/C (LMNA), transcript variant 1, mRNA.
Product prelamin-A/C isoform 1 precursor
Comment

Summary: The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Vertebrate lamins consist of two types, A and B. Through alternate splicing, this gene encodes three type A lamin isoforms. Mutations in this gene lead to several diseases: Emery-Dreifuss muscular dystrophy, familial partial lipodystrophy, limb girdle muscular dystrophy, dilated cardiomyopathy, Charcot-Marie-Tooth disease, and Hutchinson-Gilford progeria syndrome. [provided by RefSeq].


Transcript Variant: This variant (1) encodes isoform 1, also known as lamin A.

RefSeq NP_733821.1
CDS 250..2244
Exon (1)1..605
Exon (2)1..605
Exon (3)606..762
Exon (4)763..888
Exon (5)889..1059
Exon (6)1060..1185
Exon (7)1186..1406
Exon (8)1407..1629
Exon (9)1630..1737
Exon (10)1738..1857
Exon (11)1858..1947
Exon (12)1948..2217
Exon (13)2218..3225
Translation METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLR LRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARN TKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAK KQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESR LADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRID SLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQ ELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRK LESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLT YRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAM RKLVRSVTVVEDDEDEDGDDLLHHHHGSHCSSSGDPAEYNLRSRTVLCGTCGQPADKASA SGSGAQVGGPISSGSSASSVTVTRSYRSVGGSGGGSFGDNLVTRSYLLGNSSPRTQSPQN CSIM
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
27+c, tdbSNP:115067039
122+c, tdbSNP:80356803
162+g, tdbSNP:115800510
254+a, gdbSNP:11549669
265+c, tdbSNP:61046466
277..278+, adbSNP:58727209
278+c, tdbSNP:57077886
280+, cdbSNP:60029152
300+c, tdbSNP:11549668
322+c, gdbSNP:58327533
323+c, gdbSNP:61578124
324+c, tdbSNP:80356804
331+c, tdbSNP:59914820
343..345+, aagdbSNP:60872029
348+g, tdbSNP:57966821
352+c, gdbSNP:56694480
365+a, gdbSNP:57983345
376+a, gdbSNP:60446065
383+a, gdbSNP:58436778
397+a, cdbSNP:59931416
398+c, gdbSNP:60695352
407+a, tdbSNP:60290646
418+c, gdbSNP:28928903
425+g, tdbSNP:58922911
427+c, gdbSNP:28928900
433+c, gdbSNP:56793579
437+g, tdbSNP:57793737
463+c, gdbSNP:17847247
493+a, gdbSNP:59270054
503+g, tdbSNP:28933090
515+g, tdbSNP:59040894
538+a, gdbSNP:59065411
604+c, tdbSNP:17856971
606+c, tdbSNP:41313880
647+c, g, tdbSNP:60864230
668+c, g, tdbSNP:60652225
676+c, tdbSNP:61661343
677+c, tdbSNP:58912633
682+a, gdbSNP:60310264
687+c, tdbSNP:80356805
697+a, cdbSNP:58917027
730+a, gdbSNP:28933093
762+a, gdbSNP:61726477
817+c, tdbSNP:59026483
824+a, gdbSNP:57045855
834+c, gdbSNP:28933091
837+, gctgcagacdbSNP:57883991
847+a, cdbSNP:76376996
856+a, gdbSNP:61195471
857+a, gdbSNP:28933092
861+a, gdbSNP:12117552
871+, aagdbSNP:61250709
874+, adbSNP:62636507
893+c, tdbSNP:61295588
894+g, tdbSNP:80356808
913+c, tdbSNP:28928901
914+a, cdbSNP:58034145
922+c, tdbSNP:60682848
937+a, gdbSNP:61214927
940+a, cdbSNP:11549666
944+a, gdbSNP:57207746
972+a, gdbSNP:58235810
992+c, tdbSNP:58850446
995+a, gdbSNP:59332535
1000..1001+, cdbSNP:34777960
1024+g, tdbSNP:60578328
1026+a, tdbSNP:58048078
1030..1032+, aagdbSNP:58978449
1049+a, gdbSNP:57048196
1104+, gdbSNP:59564495
complement(1110)-t, g, c, adbSNP:538089
1113..1116+, ccacdbSNP:60168366
1130+a, cdbSNP:61616775
1141+c, tdbSNP:59885338
complement(1148)-t, gdbSNP:79907212
1156+c, tdbSNP:61527854
1157..1158+, ctdbSNP:59684335
1198+a, gdbSNP:56816490
1207+c, tdbSNP:3209921
1208+, tdbSNP:56771886
1225+a, tdbSNP:56851164
1241+c, gdbSNP:59301204
1256+a, gdbSNP:58105277
1266+a, gdbSNP:17847242
1271+a, cdbSNP:11549667
1277+a, gdbSNP:61177390
1295+g, tdbSNP:58789393
1321+a, gdbSNP:60458016
1334+, tdbSNP:58389804
1347+a, gdbSNP:57901307
1361+a, tdbSNP:59653062
1379+a, g, tdbSNP:61672878
1395+c, tdbSNP:57508089
1405..1406+, largedeletiondbSNP:66704199
1406+a, gdbSNP:61501994
1411+c, tdbSNP:58133342
1436+a, gdbSNP:61693978
1444+c, tdbSNP:58672172
1450+c, tdbSNP:61094188
1548+c, tdbSNP:61217436
1564+c, tdbSNP:62636506
1586+a, tdbSNP:58541611
complement(1587)-t, g, c, adbSNP:505058
1606+c, tdbSNP:58932704
1616+a, tdbSNP:60992550
1617+a, cdbSNP:61235244
1619+, adbSNP:61411888
1643+a, gdbSNP:61282106
1646+, adbSNP:58100028
1655+c, tdbSNP:57394692
1660+c, tdbSNP:28928902
1690+c, tdbSNP:57747780
1692+c, gdbSNP:56935051
1693+c, tdbSNP:57920071
1694+a, g, tdbSNP:11575937
1707+c, gdbSNP:59981161
1726+c, tdbSNP:56699480
1742+, gdbSNP:60556110
1743+g, tdbSNP:57730570
1775..1776+, cdbSNP:58013325
1784+c, tdbSNP:57877560
1800+a, gdbSNP:41314035
1808+c, gdbSNP:58362413
1828..1829+, ctgcdbSNP:58571998
1828+c, tdbSNP:57318642
1829+a, c, gdbSNP:57520892
1832+a, cdbSNP:57629361
1833+a, gdbSNP:80356812
1835+c, tdbSNP:60580541
1838+c, tdbSNP:60934003
1857+, largedeletiondbSNP:71717492
1870+c, tdbSNP:56984562
1871+a, gdbSNP:61444459
1875+c, gdbSNP:56673169
1909+c, gdbSNP:71630616
1929+c, tdbSNP:17847249
1947+c, tdbSNP:4641
1947+, largedeletiondbSNP:71792097
1967+c, tdbSNP:60890628
1982+a, tdbSNP:61224243
1994+a, gdbSNP:57830985
1997+c, tdbSNP:59601651
2000+a, gdbSNP:56657623
2010+a, gdbSNP:80356813
2039..2040+, adbSNP:34195769
2053+a, gdbSNP:60662302
2070+a, gdbSNP:59886214
2071+a, gdbSNP:61064130
2073+c, tdbSNP:58596362
2117+c, gdbSNP:59267781
2120+a, g, tdbSNP:13768
2157+c, tdbSNP:80356814
2160+c, tdbSNP:117939448
2196+c, tdbSNP:3209857
2216..2217+, largedeletiondbSNP:71640200
2217+, largedeletiondbSNP:71849874
complement(2323)-g, cdbSNP:7339
2384+g, tdbSNP:80356815
2391+a, tdbSNP:2070754
2436+a, cdbSNP:708605
2441+a, cdbSNP:115645935
2450..2451+, aaadbSNP:71735503
2453..2454+, adbSNP:71768155
2455..2456+, adbSNP:35750865
2456..2457+, aadbSNP:71786716
2585+a, c, g, tdbSNP:11549665
2609+c, tdbSNP:74116489
2637+c, tdbSNP:111601180
2983+a, gdbSNP:3204564
3159+a, c, g, tdbSNP:15292
Gene SymbolLMNA
Gene SynonymCDCD1; CDDC; CMD1A; CMT2B1; EMD2; FPL; FPLD; HGPS; IDC; LDP1; LFP; LGMD1B; LMN1; LMNC; LMNL1; PRO1
Chromosome1
Locus Map1q22
All Transcripts NM_170707 , NM_005572 , NM_170708
Title Accumulation of distinct prelamin A variants in human diploid fibroblasts differentially affects cell homeostasis .
Author Candelario,J., Borrego,S., Reddy,S. and Comai,L.
Journal Exp. Cell Res. 317 (3), 319-329 (2011)
Title Novel LMNA mutations in patients with Emery-Dreifuss muscular dystrophy and functional characterization of four LMNA mutations .
Author Scharner,J., Brown,C.A., Bower,M., Iannaccone,S.T., Khatri,I.A., Escolar,D., Gordon,E., Felice,K., Crowe,C.A., Grosmann,C., Meriggioli,M.N., Asamoah,A., Gordon,O., Gnocchi,V.F., Ellis,J.A., Mendell,J.R. and Zammit,P.S.
Journal Hum. Mutat. 32 (2), 152-167 (2011)
Title Premature senescence of vascular cells is induced by HIV protease inhibitors: implication of prelamin A and reversion by statin .
Author Lefevre,C., Auclair,M., Boccara,F., Bastard,J.P., Capeau,J., Vigouroux,C. and Caron-Debarle,M.
Journal Arterioscler. Thromb. Vasc. Biol. 30 (12), 2611-2620 (2010)
Title Two children with 'dropped head' syndrome due to lamin A/C mutations .
Author Chemla,J.C., Kanter,R.J., Carboni,M.P. and Smith,E.C.
Journal Muscle Nerve 42 (5), 839-841 (2010)
Title [Nucleopathies in children] .
Author Madej-Pilarczyk,A.
Journal Med Wieku Rozwoj 14 (4), 327-333 (2010)
Title Mouse and human hemopoietic cell lines of erythroid lineage express lamins A,B and C .
Author Martelli,A.M., Billi,A.M., Gilmour,R.S., Manzoli,L., Di Primio,R. and Cocco,L.
Journal Biochem. Biophys. Res. Commun. 185 (1), 271-276 (1992)
Title Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin .
Author Dawson,S.J. and White,L.A.
Journal J. Infect. 24 (3), 317-320 (1992)
Title Interaction of human immunodeficiency virus type I Rev protein with nuclear scaffold nucleoside triphosphatase activity .
Author Clawson,G.A., Song,Y.L., Schwartz,A.M., Shukla,R.R., Patel,S.G., Connor,L., Blankenship,L., Hatem,C. and Kumar,A.
Journal Cell Growth Differ. 2 (11), 575-582 (1991)
Title Induction of nuclear lamins A/C in macrophages in in vitro cultures of rat bone marrow precursor cells and human blood monocytes, and in macrophages elicited in vivo by thioglycollate stimulation .
Author Rober,R.A., Gieseler,R.K., Peters,J.H., Weber,K. and Osborn,M.
Journal Exp. Cell Res. 190 (2), 185-194 (1990)
Title Mutations of phosphorylation sites in lamin A that prevent nuclear lamina disassembly in mitosis .
Author Heald,R. and McKeon,F.
Journal Cell 61 (4), 579-589 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878