• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens brain-derived neurotrophic factor (BDNF), transcript variant 3, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_170731 Homo sapiens brain-derived neurotrophic factor (BDNF), transcript variant 3, mRNA. GenEZ ORF Cloning On-demand $449.00 14

*Business Day

Related Services

RefSeq Version NM_170731.4, 219842281
Length 4338 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens brain-derived neurotrophic factor (BDNF), transcript variant 3, mRNA.
Product brain-derived neurotrophic factor isoform b preproprotein
Comment

Summary: The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer's and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene. [provided by RefSeq, Jan 2009].


Transcript Variant: This variant (3), also known as I, BDNF1, or 1-5, represents use of an alternate promoter and differs in the 5' UTR and 5' coding region, compared to variant 1. The resulting isoform (b) contains a longer N-terminus compared to isoform a.

RefSeq NP_733927.1
CDS 645..1412
Misc Feature(1)219
Misc Feature(2)531..533
Misc Feature(3)837..839
Misc Feature(4)1056..1409
Exon (1)1..647
Gene:BDNF
Gene Synonym:ANON2; BULN2
Exon (2)648..4338
Gene:BDNF
Gene Synonym:ANON2; BULN2
Translation MFHQVRRVMTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAG SRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEE YKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPV SKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIR IDTSCVCTLTIKRGR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(50)-dbSNP:
complement(50)-c, adbSNP:28383487
complement(111)-g, adbSNP:7929344
complement(185)-t, cdbSNP:74407580
complement(186)-g, c, adbSNP:77559845
complement(196)-, adbSNP:34578636
complement(203)-c, adbSNP:200131453
complement(273)-t, gdbSNP:190636660
complement(418)-g, cdbSNP:185724844
complement(560)-g, adbSNP:147311377
complement(582)-t, gdbSNP:76656357
complement(626)-g, cdbSNP:191210486
complement(673)-dbSNP:
complement(673)-t, cdbSNP:8192466
complement(804)-t, cdbSNP:146354977
complement(864)-g, adbSNP:6265
complement(884)-c, adbSNP:201926642
complement(891)-g, cdbSNP:139352447
complement(893)-t, gdbSNP:1048218
complement(901)-t, cdbSNP:199638553
complement(926)-t, cdbSNP:78675155
complement(941)-t, cdbSNP:150767807
complement(961)-t, cdbSNP:141477239
complement(989)-g, cdbSNP:148736382
complement(1022)-g, adbSNP:17852698
complement(1038)-t, adbSNP:201119590
complement(1042)-t, gdbSNP:1048220
complement(1048)-t, gdbSNP:1048221
complement(1115)-t, cdbSNP:144235869
complement(1118)-g, adbSNP:2353512
complement(1131)-t, adbSNP:201468555
complement(1176)-g, adbSNP:77787410
complement(1214)-t, cdbSNP:74975314
complement(1307)-g, adbSNP:78572035
complement(1310)-g, adbSNP:138287649
complement(1578)-t, cdbSNP:142434530
complement(1590)-t, adbSNP:182639384
complement(1662)-g, adbSNP:148102034
complement(1705)-c, adbSNP:1048241
complement(1768)-t, gdbSNP:56820186
complement(1769)-, tdbSNP:3838785
complement(1801)-t, gdbSNP:190394666
complement(1985)-t, cdbSNP:58597651
complement(1999)-c, adbSNP:41282918
complement(2103)-t, cdbSNP:114775469
complement(2252)-c, adbSNP:77218393
complement(2279)-g, cdbSNP:77500722
complement(2365)-g, adbSNP:79642557
complement(2368)-t, cdbSNP:76327806
complement(2455)-t, cdbSNP:116594815
complement(2514)-g, adbSNP:187435518
complement(2576)-g, adbSNP:41282916
complement(2645)-t, cdbSNP:113432183
complement(2666)-g, cdbSNP:145801595
complement(2672)-g, adbSNP:143934500
complement(2717)-t, cdbSNP:183097055
complement(2996)-g, adbSNP:141418900
complement(3010)-t, cdbSNP:146438590
complement(3022)-g, adbSNP:143957294
complement(3193)-t, gdbSNP:11030100
complement(3196)-c, adbSNP:11030099
complement(3270)-t, gdbSNP:191977070
complement(3314)-g, adbSNP:187665907
complement(3382)-g, adbSNP:139209361
complement(3692)-t, gdbSNP:7124665
complement(3713)-t, cdbSNP:150736756
complement(3738)-t, cdbSNP:7124442
complement(3795)-g, adbSNP:41282914
complement(3818)-t, adbSNP:180803886
complement(3969)-g, adbSNP:80244532
complement(4106)-g, cdbSNP:191137757
complement(4136)-c, adbSNP:3178739
Gene SymbolBDNF
Gene SynonymANON2; BULN2
Chromosome11
Locus Map11p13
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001143805 Homo sapiens brain-derived neurotrophic factor (BDNF), transcript variant 7, mRNA. In-stock $308.00 $259.00 10
NM_001143806 Homo sapiens brain-derived neurotrophic factor (BDNF), transcript variant 8, mRNA. In-stock $308.00 $259.00 10
NM_001143807 Homo sapiens brain-derived neurotrophic factor (BDNF), transcript variant 9, mRNA. In-stock $308.00 $259.00 10
NM_001143808 Homo sapiens brain-derived neurotrophic factor (BDNF), transcript variant 10, mRNA. In-stock $308.00 $259.00 10
NM_001143809 Homo sapiens brain-derived neurotrophic factor (BDNF), transcript variant 17, mRNA. On-demand $449.00 14
NM_001143810 Homo sapiens brain-derived neurotrophic factor (BDNF), transcript variant 18, mRNA. On-demand $549.00 14
NM_001143811 Homo sapiens brain-derived neurotrophic factor (BDNF), transcript variant 11, mRNA. In-stock $308.00 $259.00 10
NM_001143812 Homo sapiens brain-derived neurotrophic factor (BDNF), transcript variant 12, mRNA. In-stock $308.00 $259.00 10
NM_001143813 Homo sapiens brain-derived neurotrophic factor (BDNF), transcript variant 13, mRNA. In-stock $308.00 $259.00 10
NM_001143814 Homo sapiens brain-derived neurotrophic factor (BDNF), transcript variant 14, mRNA. In-stock $308.00 $259.00 10
NM_001143816 Homo sapiens brain-derived neurotrophic factor (BDNF), transcript variant 16, mRNA. In-stock $308.00 $259.00 10
NM_001709 Homo sapiens brain-derived neurotrophic factor (BDNF), transcript variant 4, mRNA. In-stock $308.00 $259.00 10
NM_170731 Homo sapiens brain-derived neurotrophic factor (BDNF), transcript variant 3, mRNA. On-demand $449.00 14
NM_170732 Homo sapiens brain-derived neurotrophic factor (BDNF), transcript variant 2, mRNA. In-stock $308.00 $259.00 10
NM_170733 Homo sapiens brain-derived neurotrophic factor (BDNF), transcript variant 5, mRNA. In-stock $308.00 $259.00 10
NM_170734 Homo sapiens brain-derived neurotrophic factor (BDNF), transcript variant 6, mRNA. On-demand $449.00 14
NM_170735 Homo sapiens brain-derived neurotrophic factor (BDNF), transcript variant 1, mRNA. In-stock $308.00 $259.00 10
Title BDNF serum concentrations in first psychotic episode drug-naive schizophrenic patients: associations with personality and BDNF Val66Met polymorphism .
Author Sotiropoulou,M., Mantas,C., Bozidis,P., Marselos,M., Mavreas,V., Hyphantis,T. and Antoniou,K.
Journal Life Sci. 92 (4-5), 305-310 (2013)
Title The modifier effect of the BDNF gene in the phenotype of the WAGRO syndrome .
Author Rodriguez-Lopez,R., Perez,J.M., Balsera,A.M., Rodriguez,G.G., Moreno,T.H., Garcia de Caceres,M., Serrano,M.G., Freijo,F.C., Ruiz,J.R., Angueira,F.B., Perez,P.M., Estevez,M.N. and Gomez,E.G.
Journal Gene 516 (2), 285-290 (2013)
Title Midbrain-derived neurotrophins support survival of immature striatal projection neurons .
Author Baydyuk,M., Xie,Y., Tessarollo,L. and Xu,B.
Journal J. Neurosci. 33 (8), 3363-3369 (2013)
Title Trauma profile in Egyptian adolescents with first-episode schizophrenia: relation to psychopathology and plasma brain-derived neurotrophic factor .
Author Fawzi,M.H., Kira,I.A., Fawzi,M.M. Jr., Mohamed,H.E. and Fawzi,M.M.
Journal J. Nerv. Ment. Dis. 201 (1), 23-29 (2013)
Title Analysis of genetic polymorphisms of brain-derived neurotrophic factor and methylenetetrahydrofolate reductase in depressed patients in a Slovak (Caucasian) population .
Author Evinova,A., Babusikova,E., Straka,S., Ondrejka,I. and Lehotsky,J.
Journal Gen. Physiol. Biophys. 31 (4), 415-422 (2012)
Title Characterization of the 5'-flanking region of the human brain-derived neurotrophic factor gene .
Author Shintani,A., Ono,Y., Kaisho,Y. and Igarashi,K.
Journal Biochem. Biophys. Res. Commun. 182 (1), 325-332 (1992)
Title Chromosomal mapping of brain-derived neurotrophic factor and neurotrophin-3 genes in man and mouse .
Author Ozcelik,T., Rosenthal,A. and Francke,U.
Journal Genomics 10 (3), 569-575 (1991)
Title Human and rat brain-derived neurotrophic factor and neurotrophin-3: gene structures, distributions, and chromosomal localizations .
Author Maisonpierre,P.C., Le Beau,M.M., Espinosa,R. III, Ip,N.Y., Belluscio,L., de la Monte,S.M., Squinto,S., Furth,M.E. and Yancopoulos,G.D.
Journal Genomics 10 (3), 558-568 (1991)
Title Evolutionary studies of the nerve growth factor family reveal a novel member abundantly expressed in Xenopus ovary .
Author Hallbook,F., Ibanez,C.F. and Persson,H.
Journal Neuron 6 (5), 845-858 (1991)
Title Human platelets contain brain-derived neurotrophic factor .
Author Yamamoto,H. and Gurney,M.E.
Journal J. Neurosci. 10 (11), 3469-3478 (1990)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.