• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens brain-derived neurotrophic factor (BDNF), transcript variant 3, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu27197 Homo sapiens brain-derived neurotrophic factor (BDNF), transcript variant 3, mRNA. pcDNA3.1+-DYK On-demand $159.00 7-9
OHu27197C Homo sapiens brain-derived neurotrophic factor (BDNF), transcript variant 3, mRNA. Customized vector On-demand $209.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_170731.4, 219842281
Length 768 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens brain-derived neurotrophic factor (BDNF), transcript variant 3, mRNA.
Product brain-derived neurotrophic factor isoform b preproprotein
Comment

Summary: The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer's and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene. [provided by RefSeq, Jan 2009].


Transcript Variant: This variant (3), also known as I, BDNF1, or 1-5, represents use of an alternate promoter and differs in the 5' UTR and 5' coding region, compared to variant 1. The resulting isoform (b) contains a longer N-terminus compared to isoform a.

RefSeq NP_733927.1
CDS 645..1412
Misc Feature(1)219
Misc Feature(2)531..533
Misc Feature(3)837..839
Misc Feature(4)1056..1409
Exon (1)1..647
Gene:BDNF
Gene Synonym:ANON2; BULN2
Exon (2)648..4338
Gene:BDNF
Gene Synonym:ANON2; BULN2
Translation MFHQVRRVMTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAG SRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEE YKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPV SKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIR IDTSCVCTLTIKRGR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(50)-dbSNP:
complement(50)-c, adbSNP:28383487
complement(111)-g, adbSNP:7929344
complement(185)-t, cdbSNP:74407580
complement(186)-g, c, adbSNP:77559845
complement(186)-, adbSNP:397738894
complement(196)-, adbSNP:34578636
complement(203)-c, adbSNP:200131453
complement(273)-t, gdbSNP:190636660
complement(418)-g, cdbSNP:185724844
complement(449)-g, cdbSNP:369730594
complement(560)-g, adbSNP:147311377
582+g, tdbSNP:76656357
complement(621)-t, cdbSNP:376944501
complement(626)-g, cdbSNP:191210486
complement(673)-dbSNP:
complement(673)-t, cdbSNP:386616279
complement(747)-g, adbSNP:267602837
complement(779)-t, cdbSNP:374752426
complement(804)-t, cdbSNP:146354977
complement(864)-t, cdbSNP:386602118
complement(884)-c, adbSNP:201926642
complement(891)-g, cdbSNP:139352447
893+g, tdbSNP:1048218
complement(893)-c, adbSNP:386513217
complement(894)-t, cdbSNP:372937141
complement(901)-t, cdbSNP:199638553
complement(907)-t, cdbSNP:370382246
926+c, tdbSNP:78675155
complement(941)-t, cdbSNP:150767807
complement(961)-t, cdbSNP:141477239
complement(989)-g, cdbSNP:148736382
complement(1022)-g, adbSNP:17852698
complement(1038)-t, adbSNP:201119590
complement(1042)-t, gdbSNP:386513218
1042+g, tdbSNP:1048220
1048+g, tdbSNP:1048221
complement(1115)-t, cdbSNP:144235869
1118+a, gdbSNP:2353512
complement(1131)-t, adbSNP:201468555
complement(1148)-c, adbSNP:370102323
complement(1151)-t, gdbSNP:376008850
1176+a, gdbSNP:77787410
1214+c, tdbSNP:74975314
1307+a, gdbSNP:78572035
complement(1310)-g, adbSNP:138287649
complement(1564)-, adbSNP:368516715
complement(1578)-t, cdbSNP:142434530
complement(1588..1590)-tct, acdbSNP:386752004
complement(1590)-t, adbSNP:182639384
complement(1662)-g, adbSNP:148102034
1705+a, cdbSNP:1048241
complement(1762)-, tdbSNP:397693902
complement(1768)-t, gdbSNP:56820186
complement(1801)-t, gdbSNP:190394666
complement(1985)-t, cdbSNP:58597651
complement(1999)-c, adbSNP:41282918
complement(2103)-t, cdbSNP:114775469
complement(2252)-c, adbSNP:77218393
complement(2279)-g, cdbSNP:77500722
complement(2365)-g, adbSNP:79642557
complement(2368)-t, cdbSNP:76327806
complement(2419..2420)-, adbSNP:370922190
complement(2455)-t, cdbSNP:116594815
complement(2514)-g, adbSNP:187435518
complement(2576)-g, adbSNP:41282916
complement(2645)-t, cdbSNP:113432183
complement(2664)-, gdbSNP:377643664
complement(2666)-g, cdbSNP:145801595
complement(2672)-g, adbSNP:143934500
complement(2717)-t, cdbSNP:183097055
complement(2996)-g, adbSNP:141418900
complement(3010)-t, cdbSNP:146438590
complement(3022)-g, adbSNP:143957294
complement(3193)-t, gdbSNP:11030100
complement(3196)-c, adbSNP:11030099
complement(3270)-t, gdbSNP:191977070
complement(3314)-g, adbSNP:187665907
complement(3352)-g, adbSNP:373157604
3382+a, gdbSNP:139209361
complement(3429)-, adbSNP:373900300
complement(3578)-t, adbSNP:369836060
complement(3581)-c, adbSNP:377310701
complement(3654)-t, cdbSNP:368351549
complement(3692)-t, gdbSNP:7124665
complement(3713)-t, cdbSNP:150736756
complement(3738)-t, cdbSNP:7124442
complement(3795)-g, adbSNP:41282914
complement(3818)-t, adbSNP:180803886
complement(3889)-t, cdbSNP:369617971
3969+a, gdbSNP:80244532
complement(3970)-g, adbSNP:368036351
complement(4106)-g, cdbSNP:191137757
4136+a, cdbSNP:3178739
complement(4136)-c, adbSNP:386580528
complement(4249)-t, cdbSNP:371776547
Gene SymbolBDNF
Gene SynonymANON2; BULN2
Chromosome11
Locus Map11p13
Title Dosage effects of BDNF Val66Met polymorphism on cortical surface area and functional connectivity .
Author Wang C, Zhang Y, Liu B, Long H, Yu C and Jiang T.
Journal J. Neurosci. 34 (7), 2645-2651 (2014)
Title An adaptive role for BDNF Val66Met polymorphism in motor recovery in chronic stroke .
Author Qin L, Jing D, Parauda S, Carmel J, Ratan RR, Lee FS and Cho S.
Journal J. Neurosci. 34 (7), 2493-2502 (2014)
Title Impact of BDNF -196 G>A and BDNF -270 C>T polymorphisms on stroke rehabilitation outcome: sex and age differences .
Author Mirowska-Guzel D, Gromadzka G, Mendel T, Janus-Laszuk B, Dzierka J, Sarzynska-Dlugosz I, Czlonkowski A and Czlonkowska A.
Journal Top Stroke Rehabil 21 (SUPPL 1), S33-S41 (2014)
Title [The relationship between BDNF gene polymorphisms and alcoholics in Japan] .
Author Narita,S., Nagahori,K., Yoshihara,E., Nishizawa,D., Ikeda,K., Kawai,A. and Iwahashi,K.
Journal Nihon Arukoru Yakubutsu Igakkai Zasshi 48 (6), 407-414 (2013)
Title [Interaction effects of anxiety and the BDNF Val66Met polymorphism on attention in patients with schizophrenia spectrum disorders] .
Author Golimbet,V.E., Lebedeva,I.S., Alfimova,M.V., Korovaitseva,G.I. and Lezheiko,T.V.
Journal Zh Nevrol Psikhiatr Im S S Korsakova 113 (10), 49-54 (2013)
Title Hirschsprung Disease Overview .
Author Parisi,M.A.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Characterization of the 5'-flanking region of the human brain-derived neurotrophic factor gene .
Author Shintani A, Ono Y, Kaisho Y and Igarashi K.
Journal Biochem. Biophys. Res. Commun. 182 (1), 325-332 (1992)
Title Chromosomal mapping of brain-derived neurotrophic factor and neurotrophin-3 genes in man and mouse .
Author Ozcelik T, Rosenthal A and Francke U.
Journal Genomics 10 (3), 569-575 (1991)
Title Human and rat brain-derived neurotrophic factor and neurotrophin-3: gene structures, distributions, and chromosomal localizations .
Author Maisonpierre PC, Le Beau MM, Espinosa R 3rd, Ip NY, Belluscio L, de la Monte SM, Squinto S, Furth ME and Yancopoulos GD.
Journal Genomics 10 (3), 558-568 (1991)
Title Evolutionary studies of the nerve growth factor family reveal a novel member abundantly expressed in Xenopus ovary .
Author Hallbook F, Ibanez CF and Persson H.
Journal Neuron 6 (5), 845-858 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.