• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens keratin 6C (KRT6C), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu18637 Homo sapiens keratin 6C (KRT6C), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu18637C Homo sapiens keratin 6C (KRT6C), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_173086.4, 155969696
Length 1695 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens keratin 6C (KRT6C), mRNA.
Product keratin, type II cytoskeletal 6C
Comment

Summary: Keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into epithelial keratins and hair keratins. The type II keratins are clustered in a region of chromosome 12q13. [provided by RefSeq, Jul 2009].


##Evidence-Data-START## Transcript exon combination :: BC110639.1, L42611.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025083, ERS025084 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_775109.2
CDS 49..1743
Misc Feature(1)52..534
Misc Feature(2)52..534
Misc Feature(3)52..54
Misc Feature(4)226..228
Misc Feature(5)532..1473
Misc Feature(6)535..1464
Misc Feature(7)535..642
Misc Feature(8)643..699
Misc Feature(9)700..975
Misc Feature(10)976..1047
Misc Feature(11)1048..1464
Misc Feature(12)1156..>1491
Misc Feature(13)1288..1290
Misc Feature(14)1465..1740
Exon (1)1..588
Gene:KRT6C
Gene Synonym:K6E; KRT6E; PPKNEFD
Exon (2)589..803
Gene:KRT6C
Gene Synonym:K6E; KRT6E; PPKNEFD
Exon (3)804..864
Gene:KRT6C
Gene Synonym:K6E; KRT6E; PPKNEFD
Exon (4)865..960
Gene:KRT6C
Gene Synonym:K6E; KRT6E; PPKNEFD
Exon (5)961..1125
Gene:KRT6C
Gene Synonym:K6E; KRT6E; PPKNEFD
Exon (6)1126..1251
Gene:KRT6C
Gene Synonym:K6E; KRT6E; PPKNEFD
Exon (7)1252..1472
Gene:KRT6C
Gene Synonym:K6E; KRT6E; PPKNEFD
Exon (8)1473..1507
Gene:KRT6C
Gene Synonym:K6E; KRT6E; PPKNEFD
Exon (9)1508..2289
Gene:KRT6C
Gene Synonym:K6E; KRT6E; PPKNEFD
Translation MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSISVSRSRGSGGLGGACGGAGFGSRS LYGLGGSKRISIGGGSCAISGGYGSRAGGSYGFGGAGSGFGFGGGAGIGFGLGGGAGLAG GFGGPGFPVCPPGGIQEVTVNQSLLTPLNLQIDPAIQRVRAEEREQIKTLNNKFASFIDK VRFLEQQNKVLDTKWTLLQEQGTKTVRQNLEPLFEQYINNLRRQLDSIVGERGRLDSELR NMQDLVEDLKNKYEDEINKRTAAENEFVTLKKDVDAAYMNKVELQAKADTLTDEINFLRA LYDAELSQMQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRAEAESWYQTKY EELQVTAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCASLQAAIADAEQRGEMAL KDAKNKLEGLEDALQKAKQDLARLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGEG VGQVNVSVVQSTISSGYGGASGVGSGLGLGGGSSYSYGSGLGIGGGFSSSSGRAIGGGLS SVGGGSSTIKYTTTSSSSRKSYKH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(2)-dbSNP:
complement(2)-t, cdbSNP:369432834
complement(22)-t, cdbSNP:377008775
complement(36)-t, cdbSNP:146462738
complement(50)-g, adbSNP:199806927
complement(92)-t, cdbSNP:142765056
complement(94)-g, adbSNP:138260820
complement(95)-t, cdbSNP:145690917
complement(107)-g, adbSNP:371815641
complement(109)-t, cdbSNP:200613767
complement(132)-t, gdbSNP:148963047
complement(154)-t, cdbSNP:201473468
complement(195)-g, adbSNP:74093594
complement(228)-, adbSNP:33998545
complement(229)-g, adbSNP:201833096
231+a, gdbSNP:2885799
complement(231)-t, cdbSNP:61732948
complement(231)-c, tadbSNP:373213028
complement(246)-t, gdbSNP:28542082
complement(246)-c, adbSNP:419374
complement(310)-t, cdbSNP:149028472
complement(337)-t, cdbSNP:200653200
complement(366)-t, gdbSNP:375539593
complement(380)-t, cdbSNP:394598
complement(432)-g, adbSNP:150249318
465+c, tdbSNP:1053684
complement(476)-t, cdbSNP:151117600
complement(499)-g, adbSNP:374571234
complement(511)-t, cdbSNP:199519828
complement(525)-t, cdbSNP:372187804
complement(543)-t, cdbSNP:201509598
561..563+, caadbSNP:267607474
complement(562)-t, cdbSNP:368414844
complement(582)-g, adbSNP:375162025
complement(593)-dbSNP:
complement(593)-t, cdbSNP:11608915
complement(609)-c, adbSNP:372097391
complement(610)-t, cdbSNP:144159607
complement(627)-t, gdbSNP:375377584
complement(640)-g, adbSNP:371866729
complement(659)-t, cdbSNP:368049593
complement(662)-g, adbSNP:140286012
complement(684)-g, cdbSNP:147574610
complement(691)-t, cdbSNP:371638126
complement(713)-c, adbSNP:145109130
complement(714)-t, cdbSNP:376855829
728+a, gdbSNP:17099602
complement(729)-g, adbSNP:77218649
735+c, gdbSNP:425073
complement(736)-t, cdbSNP:144527967
complement(743)-t, c, adbSNP:370835586
complement(746)-t, cdbSNP:149302952
747+c, tdbSNP:395664
complement(749)-t, cdbSNP:12298348
750+c, tdbSNP:385476
complement(753)-t, cdbSNP:117030701
complement(759)-t, cdbSNP:142711454
complement(780)-g, adbSNP:373902514
complement(781)-t, gdbSNP:138196052
793+c, g, tdbSNP:1132951
complement(807)-dbSNP:
complement(807)-g, adbSNP:371748613
complement(826)-g, adbSNP:187821450
complement(827)-t, cdbSNP:200158036
complement(830)-t, gdbSNP:368019303
complement(848)-g, adbSNP:367775954
complement(867)-dbSNP:
complement(867)-g, adbSNP:201562541
complement(879)-g, cdbSNP:373232730
complement(893)-g, adbSNP:371438302
896+c, tdbSNP:437616
complement(901)-g, adbSNP:377674997
complement(921)-g, adbSNP:145658614
complement(924)-t, gdbSNP:374128835
complement(930)-t, cdbSNP:377509241
complement(939)-g, adbSNP:148330805
complement(943)-t, adbSNP:430612
complement(970)-dbSNP:
complement(970)-g, adbSNP:143318086
complement(977)-t, gdbSNP:375785509
complement(999)-g, adbSNP:149194468
complement(1025)-t, cdbSNP:147729627
complement(1032)-t, cdbSNP:373512100
complement(1034)-t, gdbSNP:147113111
complement(1048)-t, adbSNP:182926030
complement(1050)-g, adbSNP:369806166
complement(1051)-t, cdbSNP:372589428
complement(1070)-t, adbSNP:371894953
1071+c, tdbSNP:11540289
complement(1072)-t, cdbSNP:201362955
complement(1081)-c, adbSNP:147558225
complement(1085)-t, cdbSNP:149881707
complement(1089)-t, cdbSNP:140162855
complement(1093)-t, gdbSNP:151169574
complement(1094)-t, cdbSNP:199836454
complement(1104)-g, adbSNP:375268304
complement(1107)-t, cdbSNP:142144008
complement(1122)-t, gdbSNP:148664004
complement(1128)-dbSNP:
complement(1128)-g, adbSNP:371866175
complement(1140)-t, cdbSNP:146009218
complement(1141)-t, cdbSNP:62619943
complement(1152)-g, adbSNP:367816095
complement(1158)-g, adbSNP:201846617
complement(1164)-g, adbSNP:374280857
complement(1203)-g, adbSNP:144142819
complement(1205)-t, cdbSNP:139430353
complement(1207)-t, adbSNP:146293861
complement(1218)-t, cdbSNP:149351477
complement(1230)-c, adbSNP:371414703
1232+g, tdbSNP:1132954
1239+c, tdbSNP:11540290
complement(1249)-g, adbSNP:375678173
complement(1254)-dbSNP:
complement(1254)-g, adbSNP:138764418
1263+a, gdbSNP:11540291
1269+c, tdbSNP:11540292
complement(1285)-t, cdbSNP:374271495
complement(1300)-t, cdbSNP:375295765
complement(1304)-g, adbSNP:150638909
1305+a, cdbSNP:382367
complement(1322)-t, cdbSNP:369450600
complement(1342)-t, c, adbSNP:141915659
complement(1362)-t, cdbSNP:3894847
complement(1376)-t, cdbSNP:147097073
complement(1401)-t, cdbSNP:112260566
complement(1407)-g, adbSNP:376399948
1432..1458+, atcgccacctaccgcaagctgctggagdbSNP:267607475
complement(1434)-g, adbSNP:139369420
complement(1459)-t, cdbSNP:267603518
complement(1461)-g, adbSNP:371806019
complement(1470)-g, adbSNP:200127516
complement(1474)-dbSNP:
complement(1474)-g, cdbSNP:371468604
complement(1482)-g, c, adbSNP:11170142
complement(1483)-t, cdbSNP:143419682
complement(1489)-t, cdbSNP:412533
complement(1495)-g, adbSNP:145485697
complement(1503)-g, adbSNP:375986162
1504+a, gdbSNP:11540298
complement(1507)-g, adbSNP:372653387
complement(1511)-dbSNP:
complement(1511)-g, adbSNP:201736697
1512+a, gdbSNP:380215
complement(1515)-t, cdbSNP:391214
complement(1542)-g, adbSNP:371711981
complement(1543)-t, cdbSNP:140943956
complement(1546)-c, adbSNP:146477504
1551+c, tdbSNP:410562
complement(1557)-g, adbSNP:139360268
complement(1572)-g, adbSNP:146276081
complement(1592)-t, gdbSNP:142242212
complement(1615)-t, cdbSNP:112885852
complement(1652)-g, adbSNP:368905186
complement(1661)-g, cdbSNP:71453291
complement(1678)-t, cdbSNP:149584449
complement(1681)-t, cdbSNP:138405958
complement(1695)-t, gdbSNP:372904532
complement(1715)-g, cdbSNP:368823424
complement(1722)-t, gdbSNP:374282576
complement(1732)-t, adbSNP:147501308
complement(1734)-g, adbSNP:201858772
complement(1737)-t, cdbSNP:143211712
complement(1762)-g, cdbSNP:372306924
complement(1763)-g, cdbSNP:377681976
complement(1768)-g, adbSNP:368105013
1806+c, tdbSNP:2568
1819+a, g, tdbSNP:1053796
1822+c, gdbSNP:2567
complement(1853)-t, cdbSNP:202166218
complement(1975)-t, gdbSNP:583678
2027+a, cdbSNP:447151
complement(2064)-g, adbSNP:372790
2086+a, gdbSNP:432498
complement(2133)-g, adbSNP:144744556
complement(2165)-g, adbSNP:368004806
complement(2209)-t, adbSNP:77737438
complement(2227)-g, adbSNP:56879750
Gene SymbolKRT6C
Gene SynonymK6E; KRT6E; PPKNEFD
Chromosome12
Locus Map12q13.13
Title Collapse of the keratin filament network through the expression of mutant keratin 6c observed in a case of focal plantar keratoderma .
Author Kubo A, Oura Y, Hirano T, Aoyama Y, Sato S, Nakamura K, Takae Y and Amagai M.
Journal J. Dermatol. 40 (7), 553-557 (2013)
Title Mutations in a keratin 6 isomer (K6c) cause a type of focal palmoplantar keratoderma .
Author Bowden PE.
Journal J. Invest. Dermatol. 130 (2), 336-338 (2010)
Title Keratin K6c mutations cause focal palmoplantar keratoderma .
Author Wilson NJ, Messenger AG, Leachman SA, O'Toole EA, Lane EB, McLean
Journal J. Invest. Dermatol. 130 (2), 425-429 (2010)
Title New consensus nomenclature for mammalian keratins .
Author Schweizer J, Bowden PE, Coulombe PA, Langbein L, Lane EB, Magin TM, Maltais L, Omary MB, Parry DA, Rogers MA and Wright MW.
Journal J. Cell Biol. 174 (2), 169-174 (2006)
Title The finished DNA sequence of human chromosome 12 .
Author Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Montgomery KT, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Lovering RC, Wheeler DA, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clerc-Blankenburg KP, Davis C, Delgado O, Dinh HH, Draper H, Gonzalez-Garay ML, Havlak P, Jackson LR, Jacob LS, Kelly SH, Li L, Li Z, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Pasternak S, Perez LM, Plopper FJ, Santibanez J, Shen H, Tabor PE, Verduzco D, Waldron L, Wang Q, Williams GA, Zhang J, Zhou J, Allen CC, Amin AG, Anyalebechi V, Bailey M, Barbaria JA, Bimage KE, Bryant NP, Burch PE, Burkett CE, Burrell KL, Calderon E, Cardenas V, Carter K, Casias K, Cavazos I, Cavazos SR, Ceasar H, Chacko J, Chan SN, Chavez D, Christopoulos C, Chu J, Cockrell R, Cox CD, Dang M, Dathorne SR, David R, Davis CM, Davy-Carroll L, Deshazo DR, Donlin JE, D'Souza L, Eaves KA, Egan A, Emery-Cohen AJ, Escotto M, Flagg N, Forbes LD, Gabisi AM, Garza M, Hamilton C, Henderson N, Hernandez O, Hines S, Hogues ME, Huang M, Idlebird DG, Johnson R, Jolivet A, Jones S, Kagan R, King LM, Leal B, Lebow H, Lee S, LeVan JM, Lewis LC, London P, Lorensuhewa LM, Loulseged H, Lovett DA, Lucier A, Lucier RL, Ma J, Madu RC, Mapua P, Martindale AD, Martinez E, Massey E, Mawhiney S, Meador MG, Mendez S, Mercado C, Mercado IC, Merritt CE, Miner ZL, Minja E, Mitchell T, Mohabbat F, Mohabbat K, Montgomery B, Moore N, Morris S, Munidasa M, Ngo RN, Nguyen NB, Nickerson E, Nwaokelemeh OO, Nwokenkwo S, Obregon M, Oguh M, Oragunye N, Oviedo RJ, Parish BJ, Parker DN, Parrish J, Parks KL, Paul HA, Payton BA, Perez A, Perrin W, Pickens A, Primus EL, Pu LL, Puazo M, Quiles MM, Quiroz JB, Rabata D, Reeves K, Ruiz SJ, Shao H, Sisson I, Sonaike T, Sorelle RP, Sutton AE, Svatek AF, Svetz LA, Tamerisa KS, Taylor TR, Teague B, Thomas N, Thorn RD, Trejos ZY, Trevino BK, Ukegbu ON, Urban JB, Vasquez LI, Vera VA, Villasana DM, Wang L, Ward-Moore S, Warren JT, Wei X, White F, Williamson AL, Wleczyk R, Wooden HS, Wooden SH, Yen J, Yoon L, Yoon V, Zorrilla SE, Nelson D, Kucherlapati R, Weinstock
Journal Nature 440 (7082), 346-351 (2006)
Title Genes for intermediate filament proteins and the draft sequence of the human genome: novel keratin genes and a surprisingly high number of pseudogenes related to keratin genes 8 and 18 .
Author Hesse M, Magin TM and Weber K.
Journal J. Cell. Sci. 114 (PT 14), 2569-2575 (2001)
Title Phosphorylation of human keratin 8 in vivo at conserved head domain serine 23 and at epidermal growth factor-stimulated tail domain serine 431 .
Author Ku NO and Omary MB.
Journal J. Biol. Chem. 272 (11), 7556-7564 (1997)
Title Cloning and characterization of multiple human genes and cDNAs encoding highly related type II keratin 6 isoforms .
Author Takahashi K, Paladini RD and Coulombe PA.
Journal J. Biol. Chem. 270 (31), 18581-18592 (1995)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.