• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens keratin 6C (KRT6C), mRNA.


RefSeq Accession Definition Services Price Order
NM_173086 Homo sapiens keratin 6C (KRT6C), mRNA. ORF Sequence $491.55
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_173086.4, 155969696
Length 2345 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens keratin 6C (KRT6C), mRNA.
Product keratin, type II cytoskeletal 6C
Comment

Summary: Keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into epithelial keratins and hair keratins. The type II keratins are clustered in a region of chromosome 12q13. [provided by RefSeq, Jul 2009].


##Evidence-Data-START## Transcript exon combination :: BC110639.1, L42611.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_775109.2
CDS 49..1743
Misc Feature(1)52..534
Misc Feature(2)52..534
Misc Feature(3)52..54
Misc Feature(4)226..228
Misc Feature(5)532..1473
Misc Feature(6)535..1464
Misc Feature(7)535..642
Misc Feature(8)643..699
Misc Feature(9)700..975
Misc Feature(10)976..1047
Misc Feature(11)1048..1464
Misc Feature(12)1288..1290
Misc Feature(13)1465..1740
Exon (1)1..588
Gene:KRT6C
Gene Synonym:K6E; KRT6E
Exon (2)589..803
Gene:KRT6C
Gene Synonym:K6E; KRT6E
Exon (3)804..864
Gene:KRT6C
Gene Synonym:K6E; KRT6E
Exon (4)865..960
Gene:KRT6C
Gene Synonym:K6E; KRT6E
Exon (5)961..1125
Gene:KRT6C
Gene Synonym:K6E; KRT6E
Exon (6)1126..1251
Gene:KRT6C
Gene Synonym:K6E; KRT6E
Exon (7)1252..1472
Gene:KRT6C
Gene Synonym:K6E; KRT6E
Exon (8)1473..1507
Gene:KRT6C
Gene Synonym:K6E; KRT6E
Exon (9)1508..2289
Gene:KRT6C
Gene Synonym:K6E; KRT6E
Translation MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSISVSRSRGSGGLGGACGGAGFGSRS LYGLGGSKRISIGGGSCAISGGYGSRAGGSYGFGGAGSGFGFGGGAGIGFGLGGGAGLAG GFGGPGFPVCPPGGIQEVTVNQSLLTPLNLQIDPAIQRVRAEEREQIKTLNNKFASFIDK VRFLEQQNKVLDTKWTLLQEQGTKTVRQNLEPLFEQYINNLRRQLDSIVGERGRLDSELR NMQDLVEDLKNKYEDEINKRTAAENEFVTLKKDVDAAYMNKVELQAKADTLTDEINFLRA LYDAELSQMQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRAEAESWYQTKY EELQVTAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCASLQAAIADAEQRGEMAL KDAKNKLEGLEDALQKAKQDLARLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGEG VGQVNVSVVQSTISSGYGGASGVGSGLGLGGGSSYSYGSGLGIGGGFSSSSGRAIGGGLS SVGGGSSTIKYTTTSSSSRKSYKH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(36)-dbSNP:
complement(36)-t, cdbSNP:146462738
complement(50)-g, adbSNP:199806927
complement(92)-t, cdbSNP:142765056
complement(94)-g, adbSNP:138260820
complement(95)-t, cdbSNP:145690917
complement(109)-t, cdbSNP:200613767
complement(132)-t, gdbSNP:148963047
complement(154)-t, cdbSNP:201473468
complement(195)-g, adbSNP:74093594
complement(228)-, adbSNP:33998545
complement(229)-g, adbSNP:201833096
complement(231)-g, adbSNP:2885799
complement(246)-t, gdbSNP:28542082
complement(310)-t, cdbSNP:149028472
complement(337)-t, cdbSNP:200653200
complement(380)-t, cdbSNP:394598
complement(432)-g, adbSNP:150249318
complement(465)-t, cdbSNP:1053684
complement(476)-t, cdbSNP:151117600
complement(511)-t, cdbSNP:199519828
complement(543)-t, cdbSNP:201509598
complement(561..563)-, caadbSNP:267607474
complement(593)-dbSNP:
complement(593)-t, cdbSNP:11608915
complement(610)-t, cdbSNP:144159607
complement(662)-g, adbSNP:140286012
complement(684)-g, cdbSNP:147574610
complement(713)-c, adbSNP:145109130
complement(728)-g, adbSNP:17099602
complement(729)-g, adbSNP:77218649
complement(735)-g, cdbSNP:425073
complement(736)-t, cdbSNP:144527967
complement(746)-t, cdbSNP:149302952
complement(747)-t, cdbSNP:395664
complement(749)-t, cdbSNP:12298348
complement(750)-t, cdbSNP:385476
complement(753)-t, cdbSNP:117030701
complement(759)-t, cdbSNP:142711454
complement(781)-t, gdbSNP:138196052
complement(793)-t, cdbSNP:1132951
complement(826)-dbSNP:
complement(826)-g, adbSNP:187821450
complement(827)-t, cdbSNP:200158036
complement(867)-dbSNP:
complement(867)-g, adbSNP:201562541
complement(896)-t, cdbSNP:437616
complement(921)-g, adbSNP:145658614
complement(927)-g, adbSNP:141450473
complement(939)-g, adbSNP:148330805
complement(943)-t, adbSNP:430612
complement(970)-dbSNP:
complement(970)-g, adbSNP:143318086
complement(999)-g, adbSNP:149194468
complement(1025)-t, cdbSNP:147729627
complement(1034)-t, gdbSNP:147113111
complement(1048)-t, adbSNP:182926030
complement(1071)-t, cdbSNP:11540289
complement(1072)-t, cdbSNP:201362955
complement(1081)-c, adbSNP:147558225
complement(1085)-t, cdbSNP:149881707
complement(1089)-t, cdbSNP:140162855
complement(1093)-t, gdbSNP:151169574
complement(1094)-t, cdbSNP:199836454
complement(1107)-t, cdbSNP:142144008
complement(1122)-t, gdbSNP:148664004
complement(1140)-dbSNP:
complement(1140)-t, cdbSNP:146009218
complement(1141)-t, cdbSNP:62619943
complement(1158)-g, adbSNP:201846617
complement(1203)-g, adbSNP:144142819
complement(1205)-t, cdbSNP:139430353
complement(1207)-t, adbSNP:146293861
complement(1218)-t, cdbSNP:149351477
complement(1232)-t, gdbSNP:1132954
complement(1239)-t, cdbSNP:11540290
complement(1254)-dbSNP:
complement(1254)-g, adbSNP:138764418
complement(1263)-g, adbSNP:11540291
complement(1269)-t, cdbSNP:11540292
complement(1304)-g, adbSNP:150638909
complement(1305)-c, adbSNP:382367
complement(1342)-t, c, adbSNP:141915659
complement(1362)-t, cdbSNP:3894847
complement(1376)-t, cdbSNP:147097073
complement(1401)-t, cdbSNP:112260566
complement(1432..1458)-, atcgccacctaccgcaagctgctggagdbSNP:267607475
complement(1434)-g, adbSNP:139369420
complement(1470)-g, adbSNP:200127516
complement(1482)-dbSNP:
complement(1482)-g, c, adbSNP:11170142
complement(1483)-t, cdbSNP:143419682
complement(1489)-t, cdbSNP:412533
complement(1495)-g, adbSNP:145485697
complement(1504)-g, adbSNP:11540298
complement(1511)-dbSNP:
complement(1511)-g, adbSNP:201736697
complement(1512)-g, adbSNP:380215
complement(1515)-t, cdbSNP:391214
complement(1543)-t, cdbSNP:140943956
complement(1546)-c, adbSNP:146477504
complement(1551)-t, cdbSNP:410562
complement(1557)-g, adbSNP:139360268
complement(1572)-g, adbSNP:146276081
complement(1592)-t, gdbSNP:142242212
complement(1615)-t, cdbSNP:112885852
complement(1661)-g, cdbSNP:71453291
complement(1678)-t, cdbSNP:149584449
complement(1681)-t, cdbSNP:138405958
complement(1732)-t, adbSNP:147501308
complement(1734)-g, adbSNP:201858772
complement(1737)-t, cdbSNP:143211712
complement(1806)-t, cdbSNP:2568
complement(1819)-t, g, adbSNP:1053796
complement(1822)-g, cdbSNP:2567
complement(1853)-t, cdbSNP:202166218
complement(1975)-t, gdbSNP:583678
complement(2027)-c, adbSNP:447151
complement(2064)-g, adbSNP:372790
complement(2086)-g, adbSNP:432498
complement(2133)-g, adbSNP:144744556
complement(2209)-t, adbSNP:77737438
complement(2227)-g, adbSNP:56879750
Gene SymbolKRT6C
Gene SynonymK6E; KRT6E
Chromosome12
Locus Map12q13.13
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_173086 Homo sapiens keratin 6C (KRT6C), mRNA. Full Length $680.05
ORF Sequence $491.55
Title Mutations in a keratin 6 isomer (K6c) cause a type of focal palmoplantar keratoderma .
Author Bowden,P.E.
Journal J. Invest. Dermatol. 130 (2), 336-338 (2010)
Title Keratin K6c mutations cause focal palmoplantar keratoderma .
Author Wilson,N.J., Messenger,A.G., Leachman,S.A., O'Toole,E.A., Lane,E.B., McLean,W.H. and Smith,F.J.
Journal J. Invest. Dermatol. 130 (2), 425-429 (2010)
Title New consensus nomenclature for mammalian keratins .
Author Schweizer,J., Bowden,P.E., Coulombe,P.A., Langbein,L., Lane,E.B., Magin,T.M., Maltais,L., Omary,M.B., Parry,D.A., Rogers,M.A. and Wright,M.W.
Journal J. Cell Biol. 174 (2), 169-174 (2006)
Title The finished DNA sequence of human chromosome 12 .
Author Scherer,S.E., Muzny,D.M., Buhay,C.J., Chen,R., Cree,A., Ding,Y., Dugan-Rocha,S., Gill,R., Gunaratne,P., Harris,R.A., Hawes,A.C., Hernandez,J., Hodgson,A.V., Hume,J., Jackson,A., Khan,Z.M., Kovar-Smith,C., Lewis,L.R., Lozado,R.J., Metzker,M.L., Milosavljevic,A., Miner,G.R., Montgomery,K.T., Morgan,M.B., Nazareth,L.V., Scott,G., Sodergren,E., Song,X.Z., Steffen,D., Lovering,R.C., Wheeler,D.A., Worley,K.C., Yuan,Y., Zhang,Z., Adams,C.Q., Ansari-Lari,M.A., Ayele,M., Brown,M.J., Chen,G., Chen,Z., Clerc-Blankenburg,K.P., Davis,C., Delgado,O., Dinh,H.H., Draper,H., Gonzalez-Garay,M.L., Havlak,P., Jackson,L.R., Jacob,L.S., Kelly,S.H., Li,L., Li,Z., Liu,J., Liu,W., Lu,J., Maheshwari,M., Nguyen,B.V., Okwuonu,G.O., Pasternak,S., Perez,L.M., Plopper,F.J., Santibanez,J., Shen,H., Tabor,P.E., Verduzco,D., Waldron,L., Wang,Q., Williams,G.A., Zhang,J., Zhou,J., Allen,C.C., Amin,A.G., Anyalebechi,V., Bailey,M., Barbaria,J.A., Bimage,K.E., Bryant,N.P., Burch,P.E., Burkett,C.E., Burrell,K.L., Calderon,E., Cardenas,V., Carter,K., Casias,K., Cavazos,I., Cavazos,S.R., Ceasar,H., Chacko,J., Chan,S.N., Chavez,D., Christopoulos,C., Chu,J., Cockrell,R., Cox,C.D., Dang,M., Dathorne,S.R., David,R., Davis,C.M., Davy-Carroll,L., Deshazo,D.R., Donlin,J.E., D'Souza,L., Eaves,K.A., Egan,A., Emery-Cohen,A.J., Escotto,M., Flagg,N., Forbes,L.D., Gabisi,A.M., Garza,M., Hamilton,C., Henderson,N., Hernandez,O., Hines,S., Hogues,M.E., Huang,M., Idlebird,D.G., Johnson,R., Jolivet,A., Jones,S., Kagan,R., King,L.M., Leal,B., Lebow,H., Lee,S., LeVan,J.M., Lewis,L.C., London,P., Lorensuhewa,L.M., Loulseged,H., Lovett,D.A., Lucier,A., Lucier,R.L., Ma,J., Madu,R.C., Mapua,P., Martindale,A.D., Martinez,E., Massey,E., Mawhiney,S., Meador,M.G., Mendez,S., Mercado,C., Mercado,I.C., Merritt,C.E., Miner,Z.L., Minja,E., Mitchell,T., Mohabbat,F., Mohabbat,K., Montgomery,B., Moore,N., Morris,S., Munidasa,M., Ngo,R.N., Nguyen,N.B., Nickerson,E., Nwaokelemeh,O.O., Nwokenkwo,S., Obregon,M., Oguh,M., Oragunye,N., Oviedo,R.J., Parish,B.J., Parker,D.N., Parrish,J., Parks,K.L., Paul,H.A., Payton,B.A., Perez,A., Perrin,W., Pickens,A., Primus,E.L., Pu,L.L., Puazo,M., Quiles,M.M., Quiroz,J.B., Rabata,D., Reeves,K., Ruiz,S.J., Shao,H., Sisson,I., Sonaike,T., Sorelle,R.P., Sutton,A.E., Svatek,A.F., Svetz,L.A., Tamerisa,K.S., Taylor,T.R., Teague,B., Thomas,N., Thorn,R.D., Trejos,Z.Y., Trevino,B.K., Ukegbu,O.N., Urban,J.B., Vasquez,L.I., Vera,V.A., Villasana,D.M., Wang,L., Ward-Moore,S., Warren,J.T., Wei,X., White,F., Williamson,A.L., Wleczyk,R., Wooden,H.S., Wooden,S.H., Yen,J., Yoon,L., Yoon,V., Zorrilla,S.E., Nelson,D., Kucherlapati,R., Weinstock,G. and Gibbs,R.A.
Journal Nature 440 (7082), 346-351 (2006)
Title Genes for intermediate filament proteins and the draft sequence of the human genome: novel keratin genes and a surprisingly high number of pseudogenes related to keratin genes 8 and 18 .
Author Hesse,M., Magin,T.M. and Weber,K.
Journal J. Cell. Sci. 114 (PT 14), 2569-2575 (2001)
Title Phosphorylation of human keratin 8 in vivo at conserved head domain serine 23 and at epidermal growth factor-stimulated tail domain serine 431 .
Author Ku,N.O. and Omary,M.B.
Journal J. Biol. Chem. 272 (11), 7556-7564 (1997)
Title Cloning and characterization of multiple human genes and cDNAs encoding highly related type II keratin 6 isoforms .
Author Takahashi,K., Paladini,R.D. and Coulombe,P.A.
Journal J. Biol. Chem. 270 (31), 18581-18592 (1995)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878