• THAT   AND
  • THAT   AND


Homo sapiens docking protein 7 (DOK7), transcript variant 1, mRNA.


RefSeq Accession Definition Sequence Price Select
NM_173660 Homo sapiens docking protein 7 (DOK7), transcript variant 1, mRNA. Full Lenth $749.07
ORF Sequence $439.35


RefSeq Version NM_173660.4, 257467678
Length 2583 bp
Structure linear
Update Date 13-MAR-2011
Organism Homo sapiens (human)
Definition Homo sapiens docking protein 7 (DOK7), transcript variant 1, mRNA.
Product protein Dok-7 isoform 1
Comment

Summary: The protein encoded by this gene is essential for neuromuscular synaptogenesis. The protein functions in aneural activation of muscle-specific receptor kinase, which is required for postsynaptic differentiation, and in the subsequent clustering of the acetylcholine receptor in myotubes. This protein can also induce autophosphorylation of muscle-specific receptor kinase. Mutations in this gene are a cause of familial limb-girdle myasthenia autosomal recessive, which is also known as congenital myasthenic syndrome type 1B. Alternative splicing results in multiple transcript variants. [provided by RefSeq].


Transcript Variant: This variant (1) represents the longer and predominant variant, and encodes the longer isoform (1).

RefSeq NP_775931.3
CDS 71..1585
Exon (1)1..124
Exon (2)1..124
Exon (3)125..170
Exon (4)171..401
Exon (5)402..602
Exon (6)603..722
Exon (7)723..842
Exon (8)843..2566
Translation MTEAALVEGQVKLRDGKKWKSRWLVLRKPSPVADCLLMLVYKDKSERIKGLRERSSLTLE DICGLEPGLPYEGLVHTLAIVCLSQAIMLGFDSHEAMCAWDARIRYALGEVHRFHVTVAP GTKLESGPATLHLCNDVLVLARDIPPAVTGQWKLSDLRRYGAVPSGFIFEGGTRCGYWAG VFFLSSAEGEQISFLFDCIVRGISPTKGPFGLRPVLPDPSPPGPSTVEERVAQEALETLQ LEKRLSLLSHAGRPGSGGDDRSLSSSSSEASHLDVSASSRLTAWPEQSSSSASTSQEGPR PAAAQAAGEAMVGASRPPPKPLRPRQLQEVGRQSSSDSGIATGSHSSYSSSLSSYAGSSL DVWRATDELGSLLSLPAAGAPEPSLCTCLPGTVEYQVPTSLRAHYDTPRSLCLAPRDHSP PSQGSPGNSAARDSGGQTSAGCPSGWLGTRRRGLVMEAPQGSEATLPGPAPGEPWEAGGP HAGPPPAFFSACPVCGGLKVNPPP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
170+, adbSNP:34767819
204+c, tdbSNP:62272670
221+, cdbSNP:34654617
290+c, tdbSNP:4325970
345+a, cdbSNP:115509212
383+c, tdbSNP:115883468
393+c, tdbSNP:79740822
609+c, gdbSNP:118203994
659+a, gdbSNP:16844422
671+c, tdbSNP:118203995
823+a, gdbSNP:59932476
852+a, gdbSNP:16844460
886+c, gdbSNP:115614731
complement(903)-t, cdbSNP:3123331
906+a, gdbSNP:3135163
957+a, gdbSNP:6811423
974+c, gdbSNP:79063654
1027+a, cdbSNP:116963607
1033+a, gdbSNP:112624739
1183+a, cdbSNP:6811856
1204+a, gdbSNP:6831659
1213+c, tdbSNP:56769879
1255+c, tdbSNP:6850908
1313+c, tdbSNP:16844464
1350+a, gdbSNP:2020433
1387+c, tdbSNP:16844467
1420+a, gdbSNP:80112594
1421+c, tdbSNP:16844470
1452+a, gdbSNP:9684786
1539+c, tdbSNP:77513082
1558+a, gdbSNP:80246418
1640+c, gdbSNP:11733064
1652+c, tdbSNP:73195198
1731+c, tdbSNP:113699027
1732+a, gdbSNP:73793944
1803+a, c, g, tdbSNP:10022432
1812+a, gdbSNP:113865509
1834+c, tdbSNP:2858030
1850+a, gdbSNP:35748957
1909+, cdbSNP:35013574
2083+c, tdbSNP:75522553
2083+, tdbSNP:34564851
2090+c, tdbSNP:113495398
2096+c, tdbSNP:115237552
2104+c, tdbSNP:62272677
2213+c, gdbSNP:11542616
2224+a, gdbSNP:114480396
2271+c, tdbSNP:61163173
2298+c, tdbSNP:1054661
complement(2307)-g, adbSNP:2699414
2379+c, tdbSNP:112841601
2415+c, tdbSNP:2252054
2467+c, tdbSNP:10937930
2507+a, gdbSNP:1054662
2562+c, tdbSNP:75649328
2562+, c, tdbSNP:2105849
Gene SymbolDOK7
Gene SynonymC4orf25; CMS1B; FLJ33718; FLJ39137; FLJ90556
Chromosome4
Locus Map4p16.3
All Transcripts NM_173660 , NM_001164673
Title Congenital stridor with feeding difficulty as a presenting symptom of Dok7 congenital myasthenic syndrome .
Author Jephson,C.G., Mills,N.A., Pitt,M.C., Beeson,D., Aloysius,A., Muntoni,F., Robb,S.A. and Bailey,C.M.
Journal Int. J. Pediatr. Otorhinolaryngol. 74 (9), 991-994 (2010)
Title The cytoplasmic adaptor protein Dok7 activates the receptor tyrosine kinase MuSK via dimerization .
Author Bergamin,E., Hallock,P.T., Burden,S.J. and Hubbard,S.R.
Journal Mol. Cell 39 (1), 100-109 (2010)
Title DOK7 mutations presenting as a proximal myopathy in French Canadians .
Author Srour,M., Bolduc,V., Guergueltcheva,V., Lochmuller,H., Gendron,D., Shevell,M.I., Poulin,C., Mathieu,J., Bouchard,J.P. and Brais,B.
Journal Neuromuscul. Disord. 20 (7), 453-457 (2010)
Title Mutations in MUSK causing congenital myasthenic syndrome impair MuSK-Dok-7 interaction .
Author Maselli,R.A., Arredondo,J., Cagney,O., Ng,J.J., Anderson,J.A., Williams,C., Gerke,B.J., Soliven,B. and Wollmann,R.L.
Journal Hum. Mol. Genet. 19 (12), 2370-2379 (2010)
Title Phenotype genotype analysis in 15 patients presenting a congenital myasthenic syndrome due to mutations in DOK7 .
Author Ben Ammar,A., Petit,F., Alexandri,N., Gaudon,K., Bauche,S., Rouche,A., Gras,D., Fournier,E., Koenig,J., Stojkovic,T., Lacour,A., Petiot,P., Zagnoli,F., Viollet,L., Pellegrini,N., Orlikowski,D., Lazaro,L., Ferrer,X., Stoltenburg,G., Paturneau-Jouas,M., Hentati,F., Fardeau,M., Sternberg,D., Hantai,D., Richard,P. and Eymard,B.
Journal J. Neurol. 257 (5), 754-766 (2010)
Title Variable phenotypes associated with mutations in DOK7 .
Author Anderson,J.A., Ng,J.J., Bowe,C., McDonald,C., Richman,D.P., Wollmann,R.L. and Maselli,R.A.
Journal Muscle Nerve 37 (4), 448-456 (2008)
Title Mutations causing DOK7 congenital myasthenia ablate functional motifs in Dok-7 .
Author Hamuro,J., Higuchi,O., Okada,K., Ueno,M., Iemura,S., Natsume,T., Spearman,H., Beeson,D. and Yamanashi,Y.
Journal J. Biol. Chem. 283 (9), 5518-5524 (2008)
Title Phenotypical spectrum of DOK7 mutations in congenital myasthenic syndromes .
Author Muller,J.S., Herczegfalvi,A., Vilchez,J.J., Colomer,J., Bachinski,L.L., Mihaylova,V., Santos,M., Schara,U., Deschauer,M., Shevell,M., Poulin,C., Dias,A., Soudo,A., Hietala,M., Aarimaa,T., Krahe,R., Karcagi,V., Huebner,A., Beeson,D., Abicht,A. and Lochmuller,H.
Journal Brain 130 (PT 6), 1497-1506 (2007)
Title Dok-7 mutations underlie a neuromuscular junction synaptopathy .
Author Beeson,D., Higuchi,O., Palace,J., Cossins,J., Spearman,H., Maxwell,S., Newsom-Davis,J., Burke,G., Fawcett,P., Motomura,M., Muller,J.S., Lochmuller,H., Slater,C., Vincent,A. and Yamanashi,Y.
Journal Science 313 (5795), 1975-1978 (2006)
Title The muscle protein Dok-7 is essential for neuromuscular synaptogenesis .
Author Okada,K., Inoue,A., Okada,M., Murata,Y., Kakuta,S., Jigami,T., Kubo,S., Shiraishi,H., Eguchi,K., Motomura,M., Akiyama,T., Iwakura,Y., Higuchi,O. and Yamanashi,Y.
Journal Science 312 (5781), 1802-1805 (2006)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878