• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens harbinger transposase derived 1 (HARBI1), mRNA.


RefSeq Accession Definition Services Price Order
NM_173811 Homo sapiens harbinger transposase derived 1 (HARBI1), mRNA. ORF Sequence $304.50
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_173811.3, 224549031
Length 1530 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens harbinger transposase derived 1 (HARBI1), mRNA.
Product putative nuclease HARBI1
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK057237.1 and BM768489.1. On Mar 5, 2009 this sequence version replaced gi:31341135.


##Evidence-Data-START## Transcript exon combination :: AK057237.1, BC036925.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_776172.1
CDS 249..1298
Misc Feature(1)168..170
Misc Feature(2)690..1148
Misc Feature(3)690..1148
Exon (1)1..104
Gene:HARBI1
Gene Synonym:C11orf77
Exon (2)105..918
Gene:HARBI1
Gene Synonym:C11orf77
Exon (3)919..1522
Gene:HARBI1
Gene Synonym:C11orf77
Translation MAIPITVLDCDLLLYGRGHRTLDRFKLDDVTDEYLMSMYGFPRQFIYYLVELLGANLSRP TQRSRAISPETQVLAALGFYTSGSFQTRMGDAIGISQASMSRCVANVTEALVERASQFIR FPADEASIQALKDEFYGLAGMPGVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVC DIRGTLMTVETNWPGSLQDCAVLQQSSLSSQFEAGMHKDSWLLGDSSFFLRTWLMTPLHI PETPAEYRYNMAHSATHSVIEKTFRTLCSRFRCLDGSKGALQYSPEKSSHIILACCVLHN ISLEHGMDVWSSPMTGPMEQPPEEEYEHMESLDLEADRIRQELMLTHFS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(5)-dbSNP:
complement(5)-g, adbSNP:191845906
complement(123)-dbSNP:
complement(123)-g, adbSNP:142624067
complement(136)-g, adbSNP:77282744
complement(267)-t, cdbSNP:201911231
complement(276)-g, adbSNP:78052875
complement(301)-g, cdbSNP:199752792
complement(373)-g, adbSNP:117030196
complement(376)-t, cdbSNP:139581343
complement(444)-c, adbSNP:145989752
complement(464)-c, adbSNP:142862456
complement(493)-g, adbSNP:115211185
complement(568)-g, adbSNP:146331633
complement(590)-t, cdbSNP:183446599
complement(628)-g, adbSNP:141436294
complement(639)-g, adbSNP:148523303
complement(655)-t, cdbSNP:148294520
complement(666)-t, cdbSNP:143406663
complement(750)-g, adbSNP:149210113
complement(791)-t, gdbSNP:138485412
complement(817)-t, cdbSNP:199580977
complement(828)-g, adbSNP:200844501
complement(830)-g, adbSNP:147076911
complement(841)-t, cdbSNP:141749998
complement(870)-g, adbSNP:147599879
complement(872)-g, adbSNP:201216223
complement(895)-g, adbSNP:112306737
complement(928)-dbSNP:
complement(928)-g, adbSNP:201053799
complement(990)-g, adbSNP:201851329
complement(994)-t, cdbSNP:149901165
complement(1110)-g, adbSNP:75201515
complement(1187)-t, gdbSNP:185640614
complement(1214)-t, cdbSNP:201752855
complement(1221)-t, cdbSNP:201248157
complement(1230)-g, adbSNP:140123366
complement(1238)-g, adbSNP:35569076
complement(1327)-g, adbSNP:202159962
complement(1343)-t, gdbSNP:11038934
Gene SymbolHARBI1
Gene SynonymC11orf77
Chromosome11
Locus Map11p11.2
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_173811 Homo sapiens harbinger transposase derived 1 (HARBI1), mRNA. Full Length $443.70
ORF Sequence $304.50
Title Association of IFIH1 and other autoimmunity risk alleles with selective IgA deficiency .
Author Ferreira,R.C., Pan-Hammarstrom,Q., Graham,R.R., Gateva,V., Fontan,G., Lee,A.T., Ortmann,W., Urcelay,E., Fernandez-Arquero,M., Nunez,C., Jorgensen,G., Ludviksson,B.R., Koskinen,S., Haimila,K., Clark,H.F., Klareskog,L., Gregersen,P.K., Behrens,T.W. and Hammarstrom,L.
Journal Nat. Genet. 42 (9), 777-780 (2010)
Title Transposition of a reconstructed Harbinger element in human cells and functional homology with two transposon-derived cellular genes .
Author Sinzelle,L., Kapitonov,V.V., Grzela,D.P., Jursch,T., Jurka,J., Izsvak,Z. and Ivics,Z.
Journal Proc. Natl. Acad. Sci. U.S.A. 105 (12), 4715-4720 (2008)
Title Transcriptome analysis of human gastric cancer .
Author Oh,J.H., Yang,J.O., Hahn,Y., Kim,M.R., Byun,S.S., Jeon,Y.J., Kim,J.M., Song,K.S., Noh,S.M., Kim,S., Yoo,H.S., Kim,Y.S. and Kim,N.S.
Journal Mamm. Genome 16 (12), 942-954 (2005)
Title Harbinger transposons and an ancient HARBI1 gene derived from a transposase .
Author Kapitonov,V.V. and Jurka,J.
Journal DNA Cell Biol. 23 (5), 311-324 (2004)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878