Homo sapiens harbinger transposase derived 1 (HARBI1), mRNA.
| RefSeq Version | NM_173811.3, 224549031 |
| Length | 1530 bp |
| Structure | linear |
| Update Date | 10-MAR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens harbinger transposase derived 1 (HARBI1), mRNA. |
| Product | putative nuclease HARBI1 |
| Comment | COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK057237.1 and BM768489.1. On Mar 5, 2009 this sequence version replaced gi:31341135. COMPLETENESS: complete on the 3' end. |
| RefSeq | NP_776172.1 |
| CDS | 249..1298 | Exon (1) | 1..104 | Exon (2) | 1..104 | Exon (3) | 105..918 | Exon (4) | 919..1522 |
| Translation | MAIPITVLDCDLLLYGRGHRTLDRFKLDDVTDEYLMSMYGFPRQFIYYLVELLGANLSRP
TQRSRAISPETQVLAALGFYTSGSFQTRMGDAIGISQASMSRCVANVTEALVERASQFIR
FPADEASIQALKDEFYGLAGMPGVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVC
DIRGTLMTVETNWPGSLQDCAVLQQSSLSSQFEAGMHKDSWLLGDSSFFLRTWLMTPLHI
PETPAEYRYNMAHSATHSVIEKTFRTLCSRFRCLDGSKGALQYSPEKSSHIILACCVLHN
ISLEHGMDVWSSPMTGPMEQPPEEEYEHMESLDLEADRIRQELMLTHFS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(136) | - | g, a | dbSNP:77282744 |
| complement(276) | - | g, a | dbSNP:78052875 |
| complement(373) | - | g, a | dbSNP:117030196 |
| complement(493) | - | g, a | dbSNP:115211185 |
| complement(895) | - | g, a | dbSNP:112306737 |
| complement(1110) | - | g, a | dbSNP:75201515 |
| complement(1187) | - | t, g | dbSNP:116645140 |
| complement(1214) | - | t, c | dbSNP:117206351 |
| 1238 | + | a, g | dbSNP:35569076 |
| complement(1343) | - | t, g | dbSNP:11038934 |
| Gene Symbol | HARBI1 |
| Gene Synonym | C11orf77; FLJ32675 |
| Chromosome | 11 |
| Locus Map | 11p11.2 |
| All Transcripts | NM_173811 |
| Title | Association of IFIH1 and other autoimmunity risk alleles with selective IgA deficiency . |
| Author | Ferreira,R.C., Pan-Hammarstrom,Q., Graham,R.R., Gateva,V., Fontan,G., Lee,A.T., Ortmann,W., Urcelay,E., Fernandez-Arquero,M., Nunez,C., Jorgensen,G., Ludviksson,B.R., Koskinen,S., Haimila,K., Clark,H.F., Klareskog,L., Gregersen,P.K., Behrens,T.W. and Hammarstrom,L. |
| Journal | Nat. Genet. 42 (9), 777-780 (2010) |
| Title | Transposition of a reconstructed Harbinger element in human cells and functional homology with two transposon-derived cellular genes . |
| Author | Sinzelle,L., Kapitonov,V.V., Grzela,D.P., Jursch,T., Jurka,J., Izsvak,Z. and Ivics,Z. |
| Journal | Proc. Natl. Acad. Sci. U.S.A. 105 (12), 4715-4720 (2008) |
| Title | Transcriptome analysis of human gastric cancer . |
| Author | Oh,J.H., Yang,J.O., Hahn,Y., Kim,M.R., Byun,S.S., Jeon,Y.J., Kim,J.M., Song,K.S., Noh,S.M., Kim,S., Yoo,H.S., Kim,Y.S. and Kim,N.S. |
| Journal | Mamm. Genome 16 (12), 942-954 (2005) |
| Title | Harbinger transposons and an ancient HARBI1 gene derived from a transposase . |
| Author | Kapitonov,V.V. and Jurka,J. |
| Journal | DNA Cell Biol. 23 (5), 311-324 (2004) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |