• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens harbinger transposase derived 1 (HARBI1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu31772 Homo sapiens harbinger transposase derived 1 (HARBI1), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu31772C Homo sapiens harbinger transposase derived 1 (HARBI1), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_173811.3, 224549031
Length 1050 bp
Structure linear
Update Date 02-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens harbinger transposase derived 1 (HARBI1), mRNA.
Product putative nuclease HARBI1
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK057237.1 and BM768489.1. On Mar 5, 2009 this sequence version replaced gi:31341135.


##Evidence-Data-START## Transcript exon combination :: AK057237.1, BC036925.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025082, ERS025083 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_776172.1
CDS 249..1298
Misc Feature(1)168..170
Misc Feature(2)690..1148
Misc Feature(3)690..1148
Exon (1)1..104
Gene:HARBI1
Gene Synonym:C11orf77
Exon (2)105..918
Gene:HARBI1
Gene Synonym:C11orf77
Exon (3)919..1522
Gene:HARBI1
Gene Synonym:C11orf77
Translation MAIPITVLDCDLLLYGRGHRTLDRFKLDDVTDEYLMSMYGFPRQFIYYLVELLGANLSRP TQRSRAISPETQVLAALGFYTSGSFQTRMGDAIGISQASMSRCVANVTEALVERASQFIR FPADEASIQALKDEFYGLAGMPGVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVC DIRGTLMTVETNWPGSLQDCAVLQQSSLSSQFEAGMHKDSWLLGDSSFFLRTWLMTPLHI PETPAEYRYNMAHSATHSVIEKTFRTLCSRFRCLDGSKGALQYSPEKSSHIILACCVLHN ISLEHGMDVWSSPMTGPMEQPPEEEYEHMESLDLEADRIRQELMLTHFS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(5)-dbSNP:
complement(5)-g, adbSNP:191845906
complement(105)-dbSNP:
complement(105)-t, gdbSNP:372076348
complement(123)-g, adbSNP:142624067
complement(136)-g, adbSNP:77282744
complement(152..153)-, tdbSNP:368892119
complement(267)-t, cdbSNP:201911231
276+a, gdbSNP:78052875
complement(301)-g, cdbSNP:199752792
complement(331)-t, cdbSNP:375003116
complement(373)-g, adbSNP:117030196
complement(376)-t, cdbSNP:139581343
complement(391)-t, cdbSNP:372565562
complement(444)-c, adbSNP:145989752
complement(464)-c, adbSNP:142862456
complement(493)-g, adbSNP:115211185
complement(541)-g, adbSNP:367948574
complement(546)-t, cdbSNP:374607995
complement(555)-g, adbSNP:371776479
complement(568)-g, adbSNP:146331633
complement(575)-t, gdbSNP:367932622
complement(590)-t, cdbSNP:183446599
complement(628)-g, adbSNP:141436294
complement(639)-g, adbSNP:148523303
complement(655)-t, cdbSNP:148294520
complement(666)-t, cdbSNP:143406663
complement(667)-g, cdbSNP:367552499
complement(743)-g, adbSNP:373717082
complement(750)-g, adbSNP:149210113
complement(791)-t, gdbSNP:138485412
complement(817)-t, cdbSNP:199580977
complement(828)-g, adbSNP:200844501
complement(830)-g, adbSNP:147076911
complement(841)-t, cdbSNP:141749998
complement(870)-g, adbSNP:147599879
complement(872)-g, adbSNP:201216223
complement(895)-g, adbSNP:112306737
complement(902)-t, cdbSNP:376539269
complement(928)-dbSNP:
complement(928)-g, adbSNP:201053799
complement(939)-g, adbSNP:376775860
complement(990)-g, adbSNP:201851329
complement(993)-g, adbSNP:373268202
complement(994)-t, cdbSNP:149901165
complement(1062)-g, adbSNP:369296929
complement(1084)-t, cdbSNP:376874771
complement(1110)-g, adbSNP:75201515
complement(1187)-t, gdbSNP:185640614
complement(1189)-c, adbSNP:373418691
complement(1197)-g, adbSNP:377297419
complement(1199)-g, adbSNP:372811398
complement(1206)-g, adbSNP:369696306
complement(1214)-t, cdbSNP:201752855
complement(1221)-t, cdbSNP:201248157
complement(1230)-g, adbSNP:140123366
1238+a, gdbSNP:35569076
complement(1238)-t, cdbSNP:386583781
complement(1267)-g, cdbSNP:371969577
complement(1327)-g, adbSNP:202159962
complement(1343)-t, gdbSNP:11038934
Gene SymbolHARBI1
Gene SynonymC11orf77
Chromosome11
Locus Map11p11.2
Title Association of IFIH1 and other autoimmunity risk alleles with selective IgA deficiency .
Author Ferreira RC, Pan-Hammarstrom Q, Graham RR, Gateva V, Fontan G, Lee AT, Ortmann W, Urcelay E, Fernandez-Arquero M, Nunez C, Jorgensen G, Ludviksson BR, Koskinen S, Haimila K, Clark HF, Klareskog L, Gregersen PK, Behrens TW and Hammarstrom L.
Journal Nat. Genet. 42 (9), 777-780 (2010)
Title Transposition of a reconstructed Harbinger element in human cells and functional homology with two transposon-derived cellular genes .
Author Sinzelle L, Kapitonov VV, Grzela DP, Jursch T, Jurka J, Izsvak Z and Ivics Z.
Journal Proc. Natl. Acad. Sci. U.S.A. 105 (12), 4715-4720 (2008)
Title Transcriptome analysis of human gastric cancer .
Author Oh JH, Yang JO, Hahn Y, Kim MR, Byun SS, Jeon YJ, Kim JM, Song KS, Noh SM, Kim S, Yoo HS, Kim YS and Kim NS.
Journal Mamm. Genome 16 (12), 942-954 (2005)
Title Harbinger transposons and an ancient HARBI1 gene derived from a transposase .
Author Kapitonov VV and Jurka J.
Journal DNA Cell Biol. 23 (5), 311-324 (2004)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.