|
You are here:
Biology CRO for Drug Discovery » Molecular Biology Services » Custom ORF Cloning Services » ORF Detail
 |
Bos taurus cathelicidin 1 (CATHL1), mRNA.
| RefSeq Version | NM_174825.1, 27807340 |
| Length | 579 bp |
| Structure | linear |
| Update Date | 13-FEB-2011 |
| Organism | Bos taurus (cattle) |
| Definition | Bos taurus cathelicidin 1 (CATHL1), mRNA. |
| Product | cathelicidin-1 precursor |
| Comment | COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from L08834.1. |
| RefSeq | NP_777250.1 |
| CDS | 13..480 |
| Translation | METPRASLSLGRWSLWLLLLGLALPSASAQALSYREAVLRAVDQLNEQSSEPNIYRLLEL
DQPPQDDEDPDSPKRVSFRVKETVCSRTTQQPPEQCDFKENGLLKRCEGTVTLDQVRGNF
DITCNNHQSIRITKQPWAPPQAARLCRIVVIRVCR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| 297 | + | c, g | dbSNP:108943016 |
| Title | A whole-genome assembly of the domestic cow, Bos taurus . |
| Author | Zimin,A.V., Delcher,A.L., Florea,L., Kelley,D.R., Schatz,M.C., Puiu,D., Hanrahan,F., Pertea,G., Van Tassell,C.P., Sonstegard,T.S., Marcais,G., Roberts,M., Subramanian,P., Yorke,J.A. and Salzberg,S.L. |
| Journal | Genome Biol. 10 (4), R42 (2009) |
| Title | Purification and structural characterization of bovine cathelicidins, precursors of antimicrobial peptides . |
| Author | Storici,P., Tossi,A., Lenarcic,B. and Romeo,D. |
| Journal | Eur. J. Biochem. 238 (3), 769-776 (1996) |
| Title | cDNA sequence analysis of an antibiotic dodecapeptide from neutrophils . |
| Author | Storici,P., Del Sal,G., Schneider,C. and Zanetti,M. |
| Journal | FEBS Lett. 314 (2), 187-190 (1992) |
| Title | Structure and bactericidal activity of an antibiotic dodecapeptide purified from bovine neutrophils . |
| Author | Romeo,D., Skerlavaj,B., Bolognesi,M. and Gennaro,R. |
| Journal | J. Biol. Chem. 263 (20), 9573-9575 (1988) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |