|
You are here:
Biology CRO for Drug Discovery » Molecular Biology Services » Custom ORF Cloning Services » ORF Detail
 |
Bos taurus cathelicidin 4 (CATHL4), mRNA.
| RefSeq Version | NM_174827.2, 31341226 |
| Length | 550 bp |
| Structure | linear |
| Update Date | 10-FEB-2011 |
| Organism | Bos taurus (cattle) |
| Definition | Bos taurus cathelicidin 4 (CATHL4), mRNA. |
| Product | cathelicidin-4 precursor |
| Comment | COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from X67340.1. On Jun 3, 2003 this sequence version replaced gi:27807336. |
| RefSeq | NP_777252.1 |
| CDS | 13..447 |
| Translation | MQTQRASLSLGRWSLWLLLLGLVVPSASAQALSYREAVLRAVDQLNELSSEANLYRLLEL
DPPPKDNEDLGTRKPVSFTVKETVCPRTIQQPAEQCDFKEKGRVKQCVGTVTLDPSNDQF
DLNCNELQSVILPWKWPWWPWRRG
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| Title | A whole-genome assembly of the domestic cow, Bos taurus . |
| Author | Zimin,A.V., Delcher,A.L., Florea,L., Kelley,D.R., Schatz,M.C., Puiu,D., Hanrahan,F., Pertea,G., Van Tassell,C.P., Sonstegard,T.S., Marcais,G., Roberts,M., Subramanian,P., Yorke,J.A. and Salzberg,S.L. |
| Journal | Genome Biol. 10 (4), R42 (2009) |
| Title | Fungicidal effect of indolicidin and its interaction with phospholipid membranes . |
| Author | Lee,D.G., Kim,H.K., Kim,S.A., Park,Y., Park,S.C., Jang,S.H. and Hahm,K.S. |
| Journal | Biochem. Biophys. Res. Commun. 305 (2), 305-310 (2003) |
| Title | Structure of the bovine antimicrobial peptide indolicidin bound to dodecylphosphocholine and sodium dodecyl sulfate micelles . |
| Author | Rozek,A., Friedrich,C.L. and Hancock,R.E. |
| Journal | Biochemistry 39 (51), 15765-15774 (2000) |
| Title | cDNA cloning of the neutrophil bactericidal peptide indolicidin . |
| Author | Del Sal,G., Storici,P., Schneider,C., Romeo,D. and Zanetti,M. |
| Journal | Biochem. Biophys. Res. Commun. 187 (1), 467-472 (1992) |
| Title | Indolicidin, a novel bactericidal tridecapeptide amide from neutrophils . |
| Author | Selsted,M.E., Novotny,M.J., Morris,W.L., Tang,Y.Q., Smith,W. and Cullor,J.S. |
| Journal | J. Biol. Chem. 267 (7), 4292-4295 (1992) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |