• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ubiquitin protein ligase E3 component n-recognin 1 (UBR1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu19665 Homo sapiens ubiquitin protein ligase E3 component n-recognin 1 (UBR1), mRNA. pcDNA3.1+-DYK On-demand $2699.00 30
OHu19665C Homo sapiens ubiquitin protein ligase E3 component n-recognin 1 (UBR1), mRNA. Customized vector On-demand $2699.00 30

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_174916.2, 83656781
Length 5250 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens ubiquitin protein ligase E3 component n-recognin 1 (UBR1), mRNA.
Product E3 ubiquitin-protein ligase UBR1
Comment

Summary: The N-end rule pathway is one proteolytic pathway of the ubiquitin system. The recognition component of this pathway, encoded by this gene, binds to a destabilizing N-terminal residue of a substrate protein and participates in the formation of a substrate-linked multiubiquitin chain. This leads to the eventual degradation of the substrate protein. The protein described in this record has a RING-type zinc finger and a UBR-type zinc finger. Mutations in this gene have been associated with Johanson-Blizzard syndrome. [provided by RefSeq, Jul 2008].

RefSeq NP_777576.1
CDS 67..5316
Misc Feature(1)70..72
Misc Feature(2)70..72
Misc Feature(3)127..129
Misc Feature(4)355..567
Misc Feature(5)724..972
Misc Feature(6)3601..3603
Misc Feature(7)3601..3603
Exon (1)1..147
Gene:UBR1
Gene Synonym:JBS
Exon (2)148..404
Gene:UBR1
Gene Synonym:JBS
Exon (3)405..483
Gene:UBR1
Gene Synonym:JBS
Exon (4)484..594
Gene:UBR1
Gene Synonym:JBS
Exon (5)595..725
Gene:UBR1
Gene Synonym:JBS
Exon (6)726..864
Gene:UBR1
Gene Synonym:JBS
Exon (7)865..927
Gene:UBR1
Gene Synonym:JBS
Exon (8)928..1051
Gene:UBR1
Gene Synonym:JBS
Exon (9)1052..1159
Gene:UBR1
Gene Synonym:JBS
Exon (10)1160..1248
Gene:UBR1
Gene Synonym:JBS
Exon (11)1249..1347
Gene:UBR1
Gene Synonym:JBS
Exon (12)1348..1505
Gene:UBR1
Gene Synonym:JBS
Exon (13)1506..1605
Gene:UBR1
Gene Synonym:JBS
Exon (14)1606..1734
Gene:UBR1
Gene Synonym:JBS
Exon (15)1735..1915
Gene:UBR1
Gene Synonym:JBS
Exon (16)1916..1977
Gene:UBR1
Gene Synonym:JBS
Exon (17)1978..2088
Gene:UBR1
Gene Synonym:JBS
Exon (18)2089..2154
Gene:UBR1
Gene Synonym:JBS
Exon (19)2155..2256
Gene:UBR1
Gene Synonym:JBS
Exon (20)2257..2320
Gene:UBR1
Gene Synonym:JBS
Exon (21)2321..2445
Gene:UBR1
Gene Synonym:JBS
Exon (22)2446..2498
Gene:UBR1
Gene Synonym:JBS
Exon (23)2499..2601
Gene:UBR1
Gene Synonym:JBS
Exon (24)2602..2650
Gene:UBR1
Gene Synonym:JBS
Exon (25)2651..2805
Gene:UBR1
Gene Synonym:JBS
Exon (26)2806..2905
Gene:UBR1
Gene Synonym:JBS
Exon (27)2906..3006
Gene:UBR1
Gene Synonym:JBS
Exon (28)3007..3093
Gene:UBR1
Gene Synonym:JBS
Exon (29)3094..3275
Gene:UBR1
Gene Synonym:JBS
Exon (30)3276..3481
Gene:UBR1
Gene Synonym:JBS
Exon (31)3482..3575
Gene:UBR1
Gene Synonym:JBS
Exon (32)3576..3725
Gene:UBR1
Gene Synonym:JBS
Exon (33)3726..3823
Gene:UBR1
Gene Synonym:JBS
Exon (34)3824..3914
Gene:UBR1
Gene Synonym:JBS
Exon (35)3915..4063
Gene:UBR1
Gene Synonym:JBS
Exon (36)4064..4119
Gene:UBR1
Gene Synonym:JBS
Exon (37)4120..4216
Gene:UBR1
Gene Synonym:JBS
Exon (38)4217..4284
Gene:UBR1
Gene Synonym:JBS
Exon (39)4285..4435
Gene:UBR1
Gene Synonym:JBS
Exon (40)4436..4523
Gene:UBR1
Gene Synonym:JBS
Exon (41)4524..4657
Gene:UBR1
Gene Synonym:JBS
Exon (42)4658..4766
Gene:UBR1
Gene Synonym:JBS
Exon (43)4767..4823
Gene:UBR1
Gene Synonym:JBS
Exon (44)4824..4901
Gene:UBR1
Gene Synonym:JBS
Exon (45)4902..5072
Gene:UBR1
Gene Synonym:JBS
Exon (46)5073..5174
Gene:UBR1
Gene Synonym:JBS
Exon (47)5175..7748
Gene:UBR1
Gene Synonym:JBS
Translation MADEEAGGTERMEISAELPQTPQRLASWWDQQVDFYTAFLHHLAQLVPEIYFAEMDPDLE KQEESVQMSIFTPLEWYLFGEDPDICLEKLKHSGAFQLCGRVFKSGETTYSCRDCAIDPT CVLCMDCFQDSVHKNHRYKMHTSTGGGFCDCGDTEAWKTGPFCVNHEPGRAGTIKENSRC PLNEEVIVQARKIFPSVIKYVVEMTIWEEEKELPPELQIREKNERYYCVLFNDEHHSYDH VIYSLQRALDCELAEAQLHTTAIDKEGRRAVKAGAYAACQEAKEDIKSHSENVSQHPLHV EVLHSEIMAHQKFALRLGSWMNKIMSYSSDFRQIFCQACLREEPDSENPCLISRLMLWDA KLYKGARKILHELIFSSFFMEMEYKKLFAMEFVKYYKQLQKEYISDDHDRSISITALSVQ MFTVPTLARHLIEEQNVISVITETLLEVLPEYLDRNNKFNFQGYSQDKLGRVYAVICDLK YILISKPTIWTERLRMQFLEGFRSFLKILTCMQGMEEIRRQVGQHIEVDPDWEAAIAIQM QLKNILLMFQEWCACDEELLLVAYKECHKAVMRCSTSFISSSKTVVQSCGHSLETKSYRV SEDLVSIHLPLSRTLAGLHVRLSRLGAVSRLHEFVSFEDFQVEVLVEYPLRCLVLVAQVV AEMWRRNGLSLISQVFYYQDVKCREEMYDKDIIMLQIGASLMDPNKFLLLVLQRYELAEA FNKTISTKDQDLIKQYNTLIEEMLQVLIYIVGERYVPGVGNVTKEEVTMREIIHLLCIEP MPHSAIAKNLPENENNETGLENVINKVATFKKPGVSGHGVYELKDESLKDFNMYFYHYSK TQHSKAEHMQKKRRKQENKDEALPPPPPPEFCPAFSKVINLLNCDIMMYILRTVFERAID TDSNLWTEGMLQMAFHILALGLLEEKQQLQKAPEEEVTFDFYHKASRLGSSAMNIQMLLE KLKGIPQLEGQKDMITWILQMFDTVKRLREKSCLIVATTSGSESIKNDEITHDKEKAERK RKAEAARLHRQKIMAQMSALQKNFIETHKLMYDNTSEMPGKEDSIMEEESTPAVSDYSRI ALGPKRGPSVTEKEVLTCILCQEEQEVKIENNAMVLSACVQKSTALTQHRGKPIELSGEA LDPLFMDPDLAYGTYTGSCGHVMHAVCWQKYFEAVQLSSQQRIHVDLFDLESGEYLCPLC KSLCNTVIPIIPLQPQKINSENADALAQLLTLARWIQTVLARISGYNIRHAKGENPIPIF FNQGMGDSTLEFHSILSFGVESSIKYSNSIKEMVILFATTIYRIGLKVPPDERDPRVPML TWSTCAFTIQAIENLLGDEGKPLFGALQNRQHNGLKALMQFAVAQRITCPQVLIQKHLVR LLSVVLPNIKSEDTPCLLSIDLFHVLVGAVLAFPSLYWDDPVDLQPSSVSSSYNHLYLFH LITMAHMLQILLTVDTGLPLAQVQEDSEEAHSASSFFAEISQYTSGSIGCDIPGWYLWVS LKNGITPYLRCAALFFHYLLGVTPPEELHTNSAEGEYSALCSYLSLPTNLFLLFQEYWDT VRPLLQRWCADPALLNCLKQKNTVVRYPRKRNSLIELPDDYSCLLNQASHFRCPRSADDE RKHPVLCLFCGAILCSQNICCQEIVNGEEVGACIFHALHCGAGVCIFLKIRECRVVLVEG KARGCAYPAPYLDEYGETDPGLKRGNPLHLSRERYRKLHLVWQQHCIIEEIARSQETNQM LFGFNWQLL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(86)-c, adbSNP:141411839
complement(90)-g, adbSNP:369620073
complement(95)-t, gdbSNP:375377043
complement(111)-g, adbSNP:201825283
complement(113)-g, adbSNP:76172507
complement(124)-g, cdbSNP:150176535
complement(202)-dbSNP:
complement(202)-g, adbSNP:367696800
complement(281)-g, adbSNP:140686087
complement(283)-g, adbSNP:267604212
complement(284)-g, adbSNP:267604211
complement(309)-t, cdbSNP:79304860
complement(330)-t, cdbSNP:142558660
complement(368)-t, cdbSNP:202158437
complement(415)-dbSNP:
complement(415)-t, cdbSNP:140294470
473+a, gdbSNP:119477054
complement(476)-t, cdbSNP:201509699
complement(499)-dbSNP:
complement(499)-c, adbSNP:59574876
complement(556)-t, cdbSNP:144415580
complement(600)-dbSNP:
complement(600)-t, cdbSNP:201083590
complement(601)-g, adbSNP:139723559
complement(602)-t, cdbSNP:376029932
complement(609)-t, cdbSNP:192703766
complement(654)-t, gdbSNP:200217429
complement(665)-t, adbSNP:149864087
complement(669)-g, adbSNP:372941665
complement(670)-t, cdbSNP:190360605
complement(709)-t, gdbSNP:62020750
complement(720)-c, adbSNP:139686505
complement(777)-dbSNP:
complement(777)-t, cdbSNP:375764026
complement(786)-g, adbSNP:200504974
complement(818)-c, adbSNP:150617078
complement(832)-c, adbSNP:201386354
complement(869)-dbSNP:
complement(869)-t, cdbSNP:143887505
complement(872)-t, cdbSNP:200054312
complement(884)-g, adbSNP:191658926
complement(885)-t, cdbSNP:371383925
complement(973)-dbSNP:
complement(973)-g, adbSNP:182908361
complement(1013)-t, cdbSNP:147396426
complement(1037)-g, adbSNP:375802608
complement(1041)-g, cdbSNP:374589988
complement(1059)-dbSNP:
complement(1059)-g, adbSNP:368606031
complement(1103)-g, adbSNP:201544896
complement(1104)-t, cdbSNP:201919661
complement(1112)-t, gdbSNP:374557254
complement(1131)-t, gdbSNP:142798632
complement(1231)-dbSNP:
complement(1231)-c, adbSNP:200801495
complement(1233)-t, adbSNP:148254554
complement(1260)-dbSNP:
complement(1260)-t, cdbSNP:143184602
complement(1279)-t, cdbSNP:77360687
complement(1284)-g, adbSNP:137864901
complement(1294)-t, adbSNP:371156658
complement(1352)-dbSNP:
complement(1352)-t, cdbSNP:145247056
complement(1362)-g, adbSNP:376576173
complement(1386)-g, adbSNP:189354366
complement(1399)-g, adbSNP:183586823
complement(1404)-t, cdbSNP:377398601
complement(1443)-g, adbSNP:140270026
complement(1471)-g, adbSNP:146690613
complement(1500)-g, adbSNP:144700609
complement(1505)-t, adbSNP:374446394
complement(1551)-dbSNP:
complement(1551)-t, adbSNP:375204571
1603+c, tdbSNP:119477055
complement(1609)-dbSNP:
complement(1609)-t, cdbSNP:375176883
complement(1614..1615)-, adbSNP:377406270
complement(1791)-dbSNP:
complement(1791)-g, adbSNP:367813331
complement(1795)-t, cdbSNP:140662099
complement(1827)-t, cdbSNP:151310227
complement(1830)-t, cdbSNP:142435050
complement(1850)-g, adbSNP:148797320
complement(1853)-t, adbSNP:34568456
complement(1908)-g, adbSNP:374806707
complement(1952)-dbSNP:
complement(1952)-g, cdbSNP:375687713
complement(1977)-t, adbSNP:200515587
complement(2003)-dbSNP:
complement(2003)-g, adbSNP:374574697
complement(2070)-t, cdbSNP:199612804
complement(2105)-dbSNP:
complement(2105)-t, gdbSNP:377090547
complement(2167)-dbSNP:
complement(2167)-g, adbSNP:147859390
complement(2180)-t, cdbSNP:145364227
complement(2190)-t, cdbSNP:139911360
complement(2219)-g, adbSNP:144190668
complement(2245)-t, cdbSNP:147478213
complement(2302)-dbSNP:
complement(2302)-t, cdbSNP:200810218
complement(2304)-g, adbSNP:143160017
complement(2331)-dbSNP:
complement(2331)-g, adbSNP:139564942
complement(2334)-t, cdbSNP:201430048
complement(2347)-t, gdbSNP:111232529
complement(2368)-t, gdbSNP:200146543
complement(2381)-g, adbSNP:369213575
complement(2410)-g, adbSNP:375913511
complement(2420)-t, gdbSNP:372946259
complement(2469)-dbSNP:
complement(2469)-g, cdbSNP:141762554
complement(2471)-t, cdbSNP:374815480
complement(2553)-dbSNP:
complement(2553)-t, cdbSNP:112947825
complement(2642)-dbSNP:
complement(2642)-t, gdbSNP:111240413
complement(2658)-dbSNP:
complement(2658)-t, cdbSNP:201559284
complement(2661)-t, cdbSNP:148066298
complement(2744)-g, adbSNP:199513326
complement(2746)-t, cdbSNP:375804838
complement(2747)-g, adbSNP:141507311
complement(2761)-t, cdbSNP:35069201
complement(2787)-g, adbSNP:372822369
complement(2792)-t, cdbSNP:370452802
complement(2802)-t, cdbSNP:145463591
complement(2852)-dbSNP:
complement(2852)-g, adbSNP:113857535
complement(2889)-g, adbSNP:149061186
complement(2941)-dbSNP:
complement(2941)-g, adbSNP:200473577
complement(2952)-g, adbSNP:375465555
complement(2972)-t, cdbSNP:145788329
complement(2995)-c, adbSNP:28678764
complement(3023)-dbSNP:
complement(3023)-t, cdbSNP:112041571
complement(3072)-t, cdbSNP:183985902
complement(3086)-t, cdbSNP:376036774
complement(3087)-g, adbSNP:148993210
complement(3108)-dbSNP:
complement(3108)-t, cdbSNP:79459762
complement(3117)-t, cdbSNP:202222288
complement(3121)-t, gdbSNP:267604210
complement(3127)-t, cdbSNP:200354286
complement(3141)-g, adbSNP:141078391
complement(3160)-t, gdbSNP:181657162
complement(3180)-g, adbSNP:369951984
complement(3186)-t, cdbSNP:377343128
complement(3217)-t, cdbSNP:373336900
complement(3222)-g, adbSNP:200843098
complement(3239)-g, adbSNP:147741987
complement(3282)-dbSNP:
complement(3282)-t, cdbSNP:145695710
complement(3291)-c, adbSNP:141543407
complement(3347)-t, gdbSNP:200690084
complement(3356)-g, adbSNP:142285781
complement(3357)-t, cdbSNP:200204694
complement(3392)-g, adbSNP:368692976
complement(3417)-t, cdbSNP:373656330
complement(3449)-t, cdbSNP:371256699
complement(3464)-g, cdbSNP:377271561
complement(3477)-t, cdbSNP:185306673
complement(3486)-dbSNP:
complement(3486)-g, adbSNP:199757621
complement(3503)-t, adbSNP:374595653
complement(3516)-g, cdbSNP:144681428
complement(3558)-g, adbSNP:34803922
complement(3559)-t, cdbSNP:368770602
complement(3588)-dbSNP:
complement(3588)-g, adbSNP:144009592
complement(3593)-t, adbSNP:373216782
complement(3596)-t, adbSNP:149935389
complement(3611)-t, cdbSNP:139161796
complement(3618)-g, adbSNP:371995039
complement(3672)-c, adbSNP:369624280
complement(3735)-dbSNP:
complement(3735)-t, cdbSNP:146271578
complement(3739)-c, adbSNP:117347582
complement(3776)-t, gdbSNP:375380714
complement(3796)-g, adbSNP:187899168
complement(3807)-t, adbSNP:148375509
complement(3828)-dbSNP:
complement(3828)-t, adbSNP:370903647
complement(3857)-t, cdbSNP:139408969
complement(3863)-t, cdbSNP:201899517
complement(3889)-t, cdbSNP:199934267
complement(3906)-g, adbSNP:372354876
complement(3939)-dbSNP:
complement(3939)-t, cdbSNP:149097306
complement(3952)-t, gdbSNP:148011271
complement(3957)-g, adbSNP:374239353
complement(3960)-g, adbSNP:143517184
complement(3989)-g, adbSNP:181623854
complement(3995)-g, cdbSNP:149186253
complement(4012)-g, cdbSNP:373699629
complement(4013)-t, cdbSNP:138510410
complement(4032)-g, cdbSNP:147112447
complement(4079)-dbSNP:
complement(4079)-t, adbSNP:372661227
complement(4110)-t, cdbSNP:141869423
complement(4143)-dbSNP:
complement(4143)-t, cdbSNP:143022130
complement(4204)-t, gdbSNP:372200839
complement(4210)-g, adbSNP:16957294
complement(4218)-dbSNP:
complement(4218)-t, adbSNP:375684584
complement(4240)-g, cdbSNP:7175979
complement(4295)-dbSNP:
complement(4295)-g, adbSNP:368739715
complement(4318)-g, adbSNP:149778120
complement(4323)-g, adbSNP:200749394
complement(4336)-g, adbSNP:4375635
complement(4357)-g, adbSNP:140972409
complement(4358)-g, adbSNP:35242751
complement(4380)-g, adbSNP:4375634
complement(4385)-t, cdbSNP:200770305
complement(4386)-g, adbSNP:199500128
complement(4408)-g, adbSNP:370164043
complement(4416)-t, cdbSNP:151057109
complement(4425)-t, cdbSNP:142894633
complement(4451)-dbSNP:
complement(4451)-t, adbSNP:112540567
complement(4482)-g, adbSNP:199828697
complement(4483)-t, cdbSNP:139296068
complement(4512)-t, cdbSNP:200272415
complement(4541)-dbSNP:
complement(4541)-g, adbSNP:146245818
complement(4590)-t, adbSNP:374049779
complement(4627)-g, cdbSNP:373152125
complement(4678)-dbSNP:
complement(4678)-t, gdbSNP:201384130
complement(4682)-g, adbSNP:143431275
4708+a, g, tdbSNP:3917223
complement(4747)-t, cdbSNP:201595040
complement(4760)-c, adbSNP:201922951
complement(4810)-dbSNP:
complement(4810)-t, gdbSNP:145929255
complement(4815)-g, adbSNP:376331294
complement(4816)-t, cdbSNP:147296247
complement(4869)-dbSNP:
complement(4869)-g, adbSNP:140959617
complement(4881)-g, cdbSNP:376155272
complement(4900)-t, cdbSNP:78948790
complement(4934)-dbSNP:
complement(4934)-t, cdbSNP:373539628
complement(4935)-t, adbSNP:200344888
complement(4953)-g, adbSNP:150744789
complement(4961)-g, adbSNP:141227308
complement(5004)-g, adbSNP:35996841
complement(5007)-t, cdbSNP:368979975
complement(5034)-g, adbSNP:374962237
complement(5067)-g, adbSNP:200935129
complement(5073)-dbSNP:
complement(5073)-t, cdbSNP:113020762
complement(5100)-t, adbSNP:147089181
complement(5201)-dbSNP:
complement(5201)-t, cdbSNP:141828250
complement(5212)-g, adbSNP:201159906
complement(5268)-g, cdbSNP:139367236
complement(5271)-t, cdbSNP:16957277
complement(5274)-t, cdbSNP:375516146
complement(5279)-t, cdbSNP:149137306
complement(5311)-g, cdbSNP:201714735
complement(5313)-t, cdbSNP:145216577
complement(5334)-t, cdbSNP:373737770
complement(5350)-g, adbSNP:182619531
complement(5386)-g, cdbSNP:372216394
complement(5407)-t, adbSNP:191274063
complement(5429)-t, cdbSNP:62020698
complement(5503)-t, cdbSNP:111236961
complement(5518)-c, adbSNP:77199172
complement(5563)-g, adbSNP:367590102
5640+a, gdbSNP:3803341
complement(5659)-g, adbSNP:186367729
complement(5764)-c, adbSNP:181719334
complement(5824)-g, adbSNP:148759921
complement(5868)-t, gdbSNP:60683257
complement(6092)-t, cdbSNP:370894122
complement(6108)-g, adbSNP:190560710
complement(6116)-t, cdbSNP:118089933
complement(6120)-t, adbSNP:186595172
complement(6138)-c, adbSNP:7178732
complement(6171)-g, adbSNP:181903945
complement(6215)-c, adbSNP:79826730
complement(6231)-t, cdbSNP:7178567
complement(6358)-g, adbSNP:190464027
complement(6360)-t, cdbSNP:184351682
complement(6443)-g, adbSNP:28374170
complement(6487)-g, adbSNP:180754438
complement(6661)-c, adbSNP:375691576
complement(7088..7089)-, gdbSNP:34905366
complement(7096)-t, cdbSNP:144476911
complement(7174)-t, cdbSNP:189631484
complement(7259)-g, adbSNP:17776090
7312+g, tdbSNP:139777253
complement(7346..7347)-, gdbSNP:34368044
complement(7472)-g, adbSNP:146299171
7526+a, gdbSNP:2306126
complement(7526)-g, adbSNP:386564529
complement(7538)-t, adbSNP:79751709
complement(7578)-g, adbSNP:373880449
Gene SymbolUBR1
Gene SynonymJBS
Chromosome15
Locus Map15q13
Title Recurrent Johanson-Blizzard syndrome in a triplet pregnancy complicated by urethral obstruction sequence: a clinical, molecular, and immunohistochemical approach .
Author Schoner K, Fritz B, Huelskamp G, Louwen F, Zenker M, Moll R and Rehder H.
Journal Pediatr. Dev. Pathol. 15 (1), 50-57 (2012)
Title Novel UBR1 gene mutation in a patient with typical phenotype of Johanson-Blizzard syndrome .
Author Fallahi GH, Sabbaghian M, Khalili M, Parvaneh N, Zenker M and Rezaei N.
Journal Eur. J. Pediatr. 170 (2), 233-235 (2011)
Title Ubiquitin ligases of the N-end rule pathway: assessment of mutations in UBR1 that cause the Johanson-Blizzard syndrome .
Author Hwang CS, Sukalo M, Batygin O, Addor MC, Brunner H, Aytes AP, Mayerle J, Song HK, Varshavsky A and Zenker M.
Journal PLoS ONE 6 (9), E24925 (2011)
Title Ser(120) of Ubc2/Rad6 regulates ubiquitin-dependent N-end rule targeting by E3{alpha}/Ubr1 .
Author Kumar B, Lecompte KG, Klein JM and Haas AL.
Journal J. Biol. Chem. 285 (53), 41300-41309 (2010)
Title Johanson-Blizzard syndrome with mild phenotypic features confirmed by UBR1 gene testing .
Author Alkhouri N, Kaplan B, Kay M, Shealy A, Crowe C, Bauhuber S and Zenker M.
Journal World J. Gastroenterol. 14 (44), 6863-6866 (2008)
Title Large-scale characterization of HeLa cell nuclear phosphoproteins .
Author Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC and Gygi SP.
Journal Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135 (2004)
Title Congenital dyserythropoietic anemia type I is caused by mutations in codanin-1 .
Author Dgany O, Avidan N, Delaunay J, Krasnov T, Shalmon L, Shalev H, Eidelitz-Markus T, Kapelushnik J, Cattan D, Pariente A, Tulliez M, Cretien A, Schischmanoff PO, Iolascon A, Fibach E, Koren A, Rossler J, Le Merrer M, Yaniv I, Zaizov R, Ben-Asher E, Olender T, Lancet D, Beckmann JS and Tamary H.
Journal Am. J. Hum. Genet. 71 (6), 1467-1474 (2002)
Title The mouse and human genes encoding the recognition component of the N-end rule pathway .
Author Kwon YT, Reiss Y, Fried VA, Hershko A, Yoon JK, Gonda DK, Sangan P, Copeland NG, Jenkins NA and Varshavsky A.
Journal Proc. Natl. Acad. Sci. U.S.A. 95 (14), 7898-7903 (1998)
Title The N-end rule: functions, mysteries, uses .
Author Varshavsky A.
Journal Proc. Natl. Acad. Sci. U.S.A. 93 (22), 12142-12149 (1996)
Title A primary expression map of the chromosome 15q15 region containing the recessive form of limb-girdle muscular dystrophy (LGMD2A) gene .
Author Chiannilkulchai N, Pasturaud P, Richard I, Auffray C and Beckmann JS.
Journal Hum. Mol. Genet. 4 (4), 717-725 (1995)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.