• THAT   AND
  • THAT   AND


Rattus norvegicus trace amine-associated receptor 8c (Taar8c), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_175600 Rattus norvegicus trace amine-associated receptor 8c (Taar8c), mRNA. Full Lenth $300.15
ORF Sequence $300.15


RefSeq Version NM_175600.1, 28212217
Length 1035 bp
Structure linear
Update Date 19-FEB-2011
Organism Rattus norvegicus (Norway rat)
Definition Rattus norvegicus trace amine-associated receptor 8c (Taar8c), mRNA.
Product trace amine-associated receptor 8c
Comment

Summary: neurotransmitter/neuromodulator of trace amines; responsible for psychiatric disorders, depression and migraine [RGD].

RefSeq NP_783190.1
CDS 1..1035
Translation MTSNFSQATLQLCYENVNASCIKTPYSPGLRVLLYMVFGFGAVLAVCGNLLVVISVLHFK QLHSPANFLIASLASADFLVGISVMPFSMVRSIESCWYFGDTFCSLHSCCDVAFCYSSAL HLCFISVDRYIAVTDPLVYPTKFTVSVSGICISISWILPLVYSSAVFYTGISAMGIENLV SALNCVGGCQVVVNQDWVLISFLLFFIPTLVMIILYSKIFLVAKQQAVKIETSVSGSKGE SSLESHKARVAKRERKAAKTLGVTVLAFIVSWLPYTIDTLIDAFMGFITPAYVYEFCCWS AYYNSAMNPLIYAFFYPWFRKAMKLILSGKILKGHSSTTSLFSE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
81+a, gdbSNP:8160594
225+c, tdbSNP:8160595
969+a, gdbSNP:8160602
Gene SymbolTaar8c
Gene SynonymTa10
Chromosome1
Locus Map1p12
All Transcripts NM_175600
Title Trace amine-associated receptors form structurally and functionally distinct subfamilies of novel G protein-coupled receptors .
Author Lindemann,L., Ebeling,M., Kratochwil,N.A., Bunzow,J.R., Grandy,D.K. and Hoener,M.C.
Journal Genomics 85 (3), 372-385 (2005)
Title Trace amines: identification of a family of mammalian G protein-coupled receptors .
Author Borowsky,B., Adham,N., Jones,K.A., Raddatz,R., Artymyshyn,R., Ogozalek,K.L., Durkin,M.M., Lakhlani,P.P., Bonini,J.A., Pathirana,S., Boyle,N., Pu,X., Kouranova,E., Lichtblau,H., Ochoa,F.Y., Branchek,T.A. and Gerald,C.
Journal Proc. Natl. Acad. Sci. U.S.A. 98 (16), 8966-8971 (2001)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878