Rattus norvegicus trace amine-associated receptor 8c (Taar8c), mRNA.
| RefSeq Version | NM_175600.1, 28212217 |
| Length | 1035 bp |
| Structure | linear |
| Update Date | 19-FEB-2011 |
| Organism | Rattus norvegicus (Norway rat) |
| Definition | Rattus norvegicus trace amine-associated receptor 8c (Taar8c), mRNA. |
| Product | trace amine-associated receptor 8c |
| Comment | Summary: neurotransmitter/neuromodulator of trace amines; responsible for psychiatric disorders, depression and migraine [RGD]. |
| RefSeq | NP_783190.1 |
| CDS | 1..1035 |
| Translation | MTSNFSQATLQLCYENVNASCIKTPYSPGLRVLLYMVFGFGAVLAVCGNLLVVISVLHFK
QLHSPANFLIASLASADFLVGISVMPFSMVRSIESCWYFGDTFCSLHSCCDVAFCYSSAL
HLCFISVDRYIAVTDPLVYPTKFTVSVSGICISISWILPLVYSSAVFYTGISAMGIENLV
SALNCVGGCQVVVNQDWVLISFLLFFIPTLVMIILYSKIFLVAKQQAVKIETSVSGSKGE
SSLESHKARVAKRERKAAKTLGVTVLAFIVSWLPYTIDTLIDAFMGFITPAYVYEFCCWS
AYYNSAMNPLIYAFFYPWFRKAMKLILSGKILKGHSSTTSLFSE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| 81 | + | a, g | dbSNP:8160594 |
| 225 | + | c, t | dbSNP:8160595 |
| 969 | + | a, g | dbSNP:8160602 |
| Title | Trace amine-associated receptors form structurally and functionally distinct subfamilies of novel G protein-coupled receptors . |
| Author | Lindemann,L., Ebeling,M., Kratochwil,N.A., Bunzow,J.R., Grandy,D.K. and Hoener,M.C. |
| Journal | Genomics 85 (3), 372-385 (2005) |
| Title | Trace amines: identification of a family of mammalian G protein-coupled receptors . |
| Author | Borowsky,B., Adham,N., Jones,K.A., Raddatz,R., Artymyshyn,R., Ogozalek,K.L., Durkin,M.M., Lakhlani,P.P., Bonini,J.A., Pathirana,S., Boyle,N., Pu,X., Kouranova,E., Lichtblau,H., Ochoa,F.Y., Branchek,T.A. and Gerald,C. |
| Journal | Proc. Natl. Acad. Sci. U.S.A. 98 (16), 8966-8971 (2001) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
| Secured Online Quotation | |
| Email: gene@genscript.com | |
| Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 | |
| Fax: 1-732-210-0262 1-732-885-5878 |

