Mus musculus IQ motif containing J (Iqcj), mRNA.
| RefSeq Version | NM_177585.3, 141802156 |
| Length | 1579 bp |
| Structure | linear |
| Update Date | 19-FEB-2011 |
| Organism | Mus musculus (house mouse) |
| Definition | Mus musculus IQ motif containing J (Iqcj), mRNA. |
| Product | IQ domain-containing protein J |
| Comment | COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK052136.1. On Apr 5, 2007 this sequence version replaced gi:31340826. Sequence Note: removed 1/1 bases from the 5'/3' end that did not align to the reference genome assembly. |
| RefSeq | NP_808253.1 |
| CDS | 94..426 | Exon (1) | 1..102 | Exon (2) | 1..102 | Exon (3) | 103..167 | Exon (4) | 103..167 | Exon (5) | 168..248 | Exon (6) | 249..1579 |
| Translation | MRLEELKRLQNPLEQVDDGKYLLENHQLAMDVENNIENYPLSLQPLESKVKIIQRAWREY
LQRQDPLEKRSPSPPSVSSDKLSSSVSMNTFSDSSTPVSVSRPLAWTVLH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| 416 | + | c, t | dbSNP:30947909 |
| 703 | + | g, t | dbSNP:30947911 |
| 722 | + | g, t | dbSNP:30947913 |
| 748 | + | a, g | dbSNP:30948765 |
| 881 | + | c, g | dbSNP:30948767 |
| 921 | + | c, t | dbSNP:30948769 |
| 943 | + | c, t | dbSNP:30948771 |
| 1124 | + | c, t | dbSNP:30948773 |
| 1167 | + | c, t | dbSNP:30949585 |
| 1308 | + | a, t | dbSNP:30949587 |
| 1346 | + | a, g | dbSNP:30949588 |
| 1405 | + | c, t | dbSNP:30949590 |
| 1449 | + | a, g | dbSNP:30949592 |
| 1451 | + | a, c | dbSNP:30950444 |
| 1497 | + | a, g | dbSNP:30950446 |
| Gene Symbol | Iqcj |
| Gene Synonym | D230050A05; EG208426; MGC130259; MGC130260 |
| Chromosome | 3 |
| Locus Map | 3 |
| All Transcripts | NM_177585 |
| Title | A high-resolution anatomical atlas of the transcriptome in the mouse embryo . |
| Author | Diez-Roux,G., Banfi,S., Sultan,M., Geffers,L., Anand,S., Rozado,D., Magen,A., Canidio,E., Pagani,M., Peluso,I., Lin-Marq,N., Koch,M., Bilio,M., Cantiello,I., Verde,R., De Masi,C., Bianchi,S.A., Cicchini,J., Perroud,E., Mehmeti,S., Dagand,E., Schrinner,S., Nurnberger,A., Schmidt,K., Metz,K., Zwingmann,C., Brieske,N., Springer,C., Hernandez,A.M., Herzog,S., Grabbe,F., Sieverding,C., Fischer,B., Schrader,K., Brockmeyer,M., Dettmer,S., Helbig,C., Alunni,V., Battaini,M.A., Mura,C., Henrichsen,C.N., Garcia-Lopez,R., Echevarria,D., Puelles,E., Garcia-Calero,E., Kruse,S., Uhr,M., Kauck,C., Feng,G., Milyaev,N., Ong,C.K., Kumar,L., Lam,M., Semple,C.A., Gyenesei,A., Mundlos,S., Radelof,U., Lehrach,H., Sarmientos,P., Reymond,A., Davidson,D.R., Dolle,P., Antonarakis,S.E., Yaspo,M.L., Martinez,S., Baldock,R.A., Eichele,G. and Ballabio,A. |
| Journal | PLoS Biol. 9 (1), E1000582 (2011) |
| Title | Schwannomin-interacting protein-1 isoform IQCJ-SCHIP-1 is a late component of nodes of Ranvier and axon initial segments . |
| Author | Martin,P.M., Carnaud,M., Garcia del Cano,G., Irondelle,M., Irinopoulou,T., Girault,J.A., Dargent,B. and Goutebroze,L. |
| Journal | J. Neurosci. 28 (24), 6111-6117 (2008) |
| Title | IQCJ-SCHIP1, a novel fusion transcript encoding a calmodulin-binding IQ motif protein . |
| Author | Kwasnicka-Crawford,D.A., Carson,A.R. and Scherer,S.W. |
| Journal | Biochem. Biophys. Res. Commun. 350 (4), 890-899 (2006) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |