• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens pancreas specific transcription factor, 1a (PTF1A), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu19480 Homo sapiens pancreas specific transcription factor, 1a (PTF1A), mRNA. pcDNA3.1+-DYK On-demand $159.00 7-9
OHu19480C Homo sapiens pancreas specific transcription factor, 1a (PTF1A), mRNA. Customized vector On-demand $209.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_178161.2, 120433597
Length 987 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens pancreas specific transcription factor, 1a (PTF1A), mRNA.
Product pancreas transcription factor 1 subunit alpha
Comment

Summary: This gene encodes a protein that is a component of the pancreas transcription factor 1 complex (PTF1) and is known to have a role in mammalian pancreatic development. The protein plays a role in determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. The protein is thought to be involved in the maintenance of exocrine pancreas-specific gene expression including elastase 1 and amylase. Mutations in this gene cause cerebellar agenesis and loss of expression is seen in ductal type pancreas cancers. [provided by RefSeq, Jul 2008].

RefSeq NP_835455.1
CDS 1..987
Misc Feature(1)493..660
Misc Feature(2)493..660
Misc Feature(3)order(493..495,511..519,523..525,592..594,601..603)
Misc Feature(4)514..516
Misc Feature(5)order(532..537,544..549,553..558,604..606,613..615,
Exon (1)785..1333
Gene:PTF1A
Gene Synonym:bHLHa29; PTF1-p48
Translation MDAVLLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGDELLADEQAEVEFLSHQLHEY CYRDGACLLLQPAPPAAPLALAPPSSGGLGEPDDGGGGGYCCETGAPPGGFPYSPGSPPS CLAYPCAGAAVLSPGARLRGLSGAAAAAARRRRRVRSEAELQQLRQAANVRERRRMQSIN DAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQADLPLRGGGAGGCGGPGGGG RLGGDSPGSQAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAKV WTPEDPRKLNSKSSFNNIENEPPFEFVS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
8+dbSNP:
8+c, tdbSNP:146089816
22+c, tdbSNP:200273790
44+c, tdbSNP:140097468
75+a, cdbSNP:376887768
85+g, tdbSNP:371045580
102+c, tdbSNP:199831799
126+a, gdbSNP:141937982
133+g, tdbSNP:201397561
142+a, gdbSNP:144291757
143+a, cdbSNP:144692521
162+c, tdbSNP:117678424
164+a, gdbSNP:79353984
165+c, gdbSNP:199556852
175+a, gdbSNP:377294323
186+c, tdbSNP:142955321
190+a, gdbSNP:375826548
198+a, gdbSNP:370434971
386+c, tdbSNP:370163562
556+c, tdbSNP:373179034
786+dbSNP:
786+a, gdbSNP:199715779
787+c, tdbSNP:7918487
787+, tdbSNP:112225630
802+a, gdbSNP:139882221
836+a, gdbSNP:200834445
851+a, cdbSNP:144865627
878+a, cdbSNP:368083211
886+c, tdbSNP:104894186
890+c, gdbSNP:374698627
940+a, tdbSNP:45569235
960+a, cdbSNP:181911810
969+a, tdbSNP:147793897
1002+a, gdbSNP:10828415
1025+a, tdbSNP:140894413
1036+c, tdbSNP:368126939
1144..1146+, gatdbSNP:149560393
1177+c, tdbSNP:74121767
1246+c, gdbSNP:144824953
Gene SymbolPTF1A
Gene SynonymbHLHa29; PTF1-p48
Chromosome10
Locus Map10p12.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_178161 Homo sapiens pancreas specific transcription factor, 1a (PTF1A), mRNA. On-demand TBD TBD
Title Recessive mutations in a distal PTF1A enhancer cause isolated pancreatic agenesis .
Author Weedon MN, Cebola I, Patch AM, Flanagan SE, De Franco E, Caswell R, Rodriguez-Segui SA, Shaw-Smith C, Cho CH, Lango Allen H, Houghton JA, Roth CL, Chen R, Hussain K, Marsh P, Vallier L, Murray A, Ellard S, Ferrer J and Hattersley AT.
Journal Nat. Genet. 46 (1), 61-64 (2014)
Title ICAT is a novel Ptf1a interactor that regulates pancreatic acinar differentiation and displays altered expression in tumours .
Author Campos ML, Sanchez-Arevalo Lobo VJ, Rodolosse A, Gottardi CJ, Mafficini A, Beghelli S, Scardoni M, Bassi C, Scarpa A and Real FX.
Journal Biochem. J. 451 (3), 395-405 (2013)
Title Genetic lineage tracing, a powerful tool to investigate the embryonic organogenesis and adult organ maintenance of the pancreas .
Author Kawaguchi Y, Takaori K and Uemoto S.
Journal J Hepatobiliary Pancreat Sci 18 (1), 1-5 (2011)
Title Multiple transcriptional mechanisms control Ptf1a levels during neural development including autoregulation by the PTF1-J complex .
Author Meredith DM, Masui T, Swift GH, MacDonald RJ and Johnson JE.
Journal J. Neurosci. 29 (36), 11139-11148 (2009)
Title A Turkish newborn infant with cerebellar agenesis/neonatal diabetes mellitus and PTF1A mutation .
Author Tutak E, Satar M, Yapicioglu H, Altintas A, Narli N, Herguner O and Bayram Y.
Journal Genet. Couns. 20 (2), 147-152 (2009)
Title The bHLH protein PTF1-p48 is essential for the formation of the exocrine and the correct spatial organization of the endocrine pancreas .
Author Krapp A, Knofler M, Ledermann B, Burki K, Berney C, Zoerkler N, Hagenbuchle O and Wellauer PK.
Journal Genes Dev. 12 (23), 3752-3763 (1998)
Title Constitutive expression of the gene for the cell-specific p48 DNA-binding subunit of pancreas transcription factor 1 in cultured cells is under control of binding sites for transcription factors Sp1 and alphaCbf .
Author Knofler M, Krapp A, Hagenbuchle O and Wellauer PK.
Journal J. Biol. Chem. 271 (36), 21993-22002 (1996)
Title The p48 DNA-binding subunit of transcription factor PTF1 is a new exocrine pancreas-specific basic helix-loop-helix protein .
Author Krapp A, Knofler M, Frutiger S, Hughes GJ, Hagenbuchle O and Wellauer PK.
Journal EMBO J. 15 (16), 4317-4329 (1996)
Title Nuclear targeting of the transcription factor PTF1 is mediated by a protein subunit that does not bind to the PTF1 cognate sequence .
Author Sommer L, Hagenbuchle O, Wellauer PK and Strubin M.
Journal Cell 67 (5), 987-994 (1991)
Title The cell-specific transcription factor PTF1 contains two different subunits that interact with the DNA .
Author Roux E, Strubin M, Hagenbuchle O and Wellauer PK.
Journal Genes Dev. 3 (10), 1613-1624 (1989)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.