Search Tips

  • THAT   AND
  • THAT   AND


Danio rerio arginine vasopressin-like (avpl), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_178293 Danio rerio arginine vasopressin-like (avpl), mRNA. Full Lenth $189.00
ORF Sequence $159.00
RefSeq Version NM_178293.2, 31342114
Length 540 bp
Structure linear
Update Date 26-FEB-2011
Organism Danio rerio (zebrafish)
Definition Danio rerio arginine vasopressin-like (avpl), mRNA.
Product vasopressin-neurophysin 2-copeptin
Comment

COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AY168623.1. On Jun 3, 2003 this sequence version replaced gi:30231235.
RefSeq NP_840078.1
CDS 5..454
Translation MSDSLLSVCVLCVLALSTLSSACYIQNCPRGGKRSQPEPIRQCMSCGPGGVGRCFGPSIC CGPGLGCVLGSPEAQVCMEEEQLSGPCETGGTSCGDRGGRCAAEGICCDSESCAVDPDCP EGSSAGLKSISGETLLRLLNLATRRQRPF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
Gene Symbolavpl
Gene Synonymvsnp; VT-NP
Chromosome8
Locus Map8
All Transcripts NM_178293
Title Circadian rhythms in the pineal organ persist in zebrafish larvae that lack ventral brain .
Author Noche,R.R., Lu,P.N., Goldstein-Kral,L., Glasgow,E. and Liang,J.O.
Journal BMC Neurosci 12, 7 (2011)
Title Unravelling the neurophysiological basis of aggression in a fish model .
Author Filby,A.L., Paull,G.C., Hickmore,T.F. and Tyler,C.R.
Journal BMC Genomics 11, 498 (2010)
Title Zebrafish diencephalic A11-related dopaminergic neurons share a conserved transcriptional network with neuroendocrine cell lineages .
Author Lohr,H., Ryu,S. and Driever,W.
Journal Development 136 (6), 1007-1017 (2009)
Title Neuroendocrine transcriptional programs adapt dynamically to the supply and demand for neuropeptides as revealed in NSF mutant zebrafish .
Author Kurrasch,D.M., Nevin,L.M., Wong,J.S., Baier,H. and Ingraham,H.A.
Journal Neural Dev 4, 22 (2009)
Title Ontogeny of vasotocin-expressing cells in zebrafish: selective requirement for the transcriptional regulators orthopedia and single-minded 1 in the preoptic area .
Author Eaton,J.L., Holmqvist,B. and Glasgow,E.
Journal Dev. Dyn. 237 (4), 995-1005 (2008)
Title Conserved sensory-neurosecretory cell types in annelid and fish forebrain: insights into hypothalamus evolution .
Author Tessmar-Raible,K., Raible,F., Christodoulou,F., Guy,K., Rembold,M., Hausen,H. and Arendt,D.
Journal Cell 129 (7), 1389-1400 (2007)
Title Aggression and vasotocin are associated with dominant-subordinate relationships in zebrafish .
Author Larson,E.T., O'Malley,D.M. and Melloni,R.H. Jr.
Journal Behav. Brain Res. 167 (1), 94-102 (2006)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878