• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ankyrin repeat and kinase domain containing 1 (ANKK1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu17836 Homo sapiens ankyrin repeat and kinase domain containing 1 (ANKK1), mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu17836C Homo sapiens ankyrin repeat and kinase domain containing 1 (ANKK1), mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_178510.1, 30425443
Length 2298 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens ankyrin repeat and kinase domain containing 1 (ANKK1), mRNA.
Product ankyrin repeat and protein kinase domain-containing protein 1
Comment

Summary: The protein encoded by this gene belongs to the Ser/Thr protein kinase family, and protein kinase superfamily involved in signal transduction pathways. This gene is closely linked to DRD2 gene (GeneID:1813) on chr 11, and a well studied restriction fragment length polymorphism (RFLP) designated TaqIA, was originally associated with the DRD2 gene, however, later was determined to be located in exon 8 of ANKK1 gene (PMIDs: 18621654, 15146457), where it causes a nonconservative amino acid substitution. It is not clear if this gene plays any role in neuropsychiatric disorders previously associated with Taq1A RFLP. [provided by RefSeq, Sep 2009].

RefSeq NP_848605.1
CDS 95..2392
Misc Feature(1)170..937
Misc Feature(2)170..937
Misc Feature(3)182..937
Misc Feature(4)order(182..190,200..202,239..241,245..247,344..346,
Misc Feature(5)order(182..190,200..202,239..241,245..247,344..346,
Misc Feature(6)order(188..190,407..409,413..415,527..529,533..535,
Misc Feature(7)order(578..598,650..661)
Misc Feature(8)1163..1300
Misc Feature(9)1175..1264
Misc Feature(10)1190..1465
Misc Feature(11)1259..1633
Misc Feature(12)1274..1363
Misc Feature(13)1373..1462
Misc Feature(14)1388..1663
Misc Feature(15)1472..1561
Misc Feature(16)1556..1930
Misc Feature(17)1571..1660
Misc Feature(18)1670..1759
Misc Feature(19)1685..1948
Misc Feature(20)1754..2131
Misc Feature(21)1769..1858
Misc Feature(22)1868..1957
Misc Feature(23)1883..2161
Misc Feature(24)1967..2056
Misc Feature(25)1973..2326
Misc Feature(26)2066..2155
Misc Feature(27)2165..2254
Misc Feature(28)2168..2326
Misc Feature(29)2264..2353
Exon (1)1..279
Gene:ANKK1
Gene Synonym:PKK2
Exon (2)280..574
Gene:ANKK1
Gene Synonym:PKK2
Exon (3)575..726
Gene:ANKK1
Gene Synonym:PKK2
Exon (4)727..776
Gene:ANKK1
Gene Synonym:PKK2
Exon (5)777..932
Gene:ANKK1
Gene Synonym:PKK2
Exon (6)933..1051
Gene:ANKK1
Gene Synonym:PKK2
Exon (7)1052..1088
Gene:ANKK1
Gene Synonym:PKK2
Exon (8)1089..2543
Gene:ANKK1
Gene Synonym:PKK2
Translation MAADPTELRLGSLPVFTRDDFEGDWRLVASGGFSQVFQARHRRWRTEYAIKCAPCLPPDA ASSDVNYLIEEAAKMKKIKFQHIVSIYGVCKQPLGIVMEFMANGSLEKVLSTHSLCWKLR FRIIHETSLAMNFLHSIKPPLLHLDLKPGNILLDSNMHVKISDFGLSKWMEQSTRMQYIE RSALRGMLSYIPPEMFLESNKAPGPKYDVYSFAIVIWELLTQKKPYSGFNMMMIIIRVAA GMRPSLQPVSDQWPSEAQQMVDLMKRCWDQDPKKRPCFLDITIETDILLSLLQSRVAVPE SKALARKVSCKLSLRQPGEVNEDISQELMDSDSGNYLKRALQLSDRKNLVPRDEELCIYE NKVTPLHFLVAQGSVEQVRLLLAHEVDVDCQTASGYTPLLIAAQDQQPDLCALLLAHGAD ANRVDEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQEREGWTPLHLAAQNNFENVARLL VSRQADPNLHEAEGKTPLHVAAYFGHVSLVKLLTSQGAELDAQQRNLRTPLHLAVERGKV RAIQHLLKSGAVPDALDQSGYGPLHTAAARGKYLICKMLLRYGASLELPTHQGWTPLHLA AYKGHLEIIHLLAESHANMGALGAVNWTPLHLAARHGEEAVVSALLQCGADPNAAEQSGW TPLHLAVQRSTFLSVINLLEHHANVHARNKVGWTPAHLAALKGNTAILKVLVEAGAQLDV QDGVSCTPLQLALRSRKQGIMSFLEGKEPSVATLGGSKPGAEMEI
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
42+dbSNP:
42+a, tdbSNP:369673907
51+a, cdbSNP:111334073
104+g, tdbSNP:35657708
146+c, tdbSNP:371434196
187..188+, gdbSNP:142610545
207+a, tdbSNP:201008406
221+a, cdbSNP:368483324
250+c, gdbSNP:111789052
265+a, tdbSNP:371871655
275+a, gdbSNP:181883517
303+dbSNP:
303+a, gdbSNP:368774233
321+a, gdbSNP:201185165
343+c, tdbSNP:201933022
344+c, gdbSNP:369480293
346+a, gdbSNP:373051400
349+c, tdbSNP:17115439
356+a, gdbSNP:201291015
404+a, gdbSNP:370893401
408+c, tdbSNP:373395692
415+c, gdbSNP:200273061
425+c, tdbSNP:77948690
458+c, tdbSNP:370146394
459+a, gdbSNP:35877321
468+a, gdbSNP:367944155
498+a, cdbSNP:202206437
501+a, gdbSNP:199783502
511+a, gdbSNP:201489078
537+c, tdbSNP:200103052
544+c, tdbSNP:58224139
547+a, cdbSNP:4938013
591+dbSNP:
591+g, tdbSNP:141919233
617+c, tdbSNP:373295480
618+a, gdbSNP:375367141
632+a, gdbSNP:150678579
640+a, gdbSNP:140803658
648+a, gdbSNP:115800217
671+c, gdbSNP:371127439
721+g, tdbSNP:372467643
727+dbSNP:
727+c, gdbSNP:368487415
739+c, tdbSNP:372845149
772+a, cdbSNP:375917085
775+a, gdbSNP:367585993
783+dbSNP:
783+a, cdbSNP:200624485
787+a, gdbSNP:377018695
801+a, c, tdbSNP:201608349
803+c, tdbSNP:56047699
804+a, gdbSNP:199582150
809+a, gdbSNP:7118900
810+c, tdbSNP:190009110
811+a, gdbSNP:371011304
851+c, tdbSNP:201098042
859+c, tdbSNP:368657217
916+a, gdbSNP:371779915
918+a, gdbSNP:146498786
921+c, tdbSNP:35488601
934+dbSNP:
934+a, cdbSNP:138608171
944+a, gdbSNP:45466992
978+g, tdbSNP:199747130
1037+c, tdbSNP:114931186
1046+a, gdbSNP:11604671
1084+dbSNP:
1084+c, tdbSNP:367599961
1122+dbSNP:
1122+c, tdbSNP:202009146
1126+c, tdbSNP:377262479
1127+a, gdbSNP:139270089
1128+a, gdbSNP:199662373
1130+c, tdbSNP:201257762
1145+c, tdbSNP:186633697
1162+a, gdbSNP:376825165
1190+c, tdbSNP:56339158
1195+a, cdbSNP:34298987
1220+a, gdbSNP:56299709
1246+c, tdbSNP:376689251
1255+c, tdbSNP:17115457
1282+c, tdbSNP:373311747
1298+a, gdbSNP:376444957
1301+a, gdbSNP:370140219
1306+a, gdbSNP:267602696
1307+a, gdbSNP:267602697
1309+c, tdbSNP:373849007
1310+c, gdbSNP:200699123
1370+a, gdbSNP:55699907
1417+c, tdbSNP:199986656
1418+c, g, tdbSNP:4938016
1425+c, tdbSNP:374849691
1427+c, tdbSNP:78229381
1428+a, gdbSNP:201891002
complement(1436)-g, adbSNP:2587555
1444+c, tdbSNP:56005821
1445+a, gdbSNP:34983219
1467+a, gdbSNP:184645039
1481+a, tdbSNP:370088482
1527+a, gdbSNP:200848862
complement(1563)-t, cdbSNP:2734849
1563+a, gdbSNP:386572908
1567+c, gdbSNP:199896606
1578+a, gdbSNP:376661130
1581+a, cdbSNP:201207634
1581+, cdbSNP:200507206
1582+c, tdbSNP:200848219
1598+a, gdbSNP:369229013
complement(1628)-t, gdbSNP:2587554
1639+c, tdbSNP:372776088
1663+c, gdbSNP:199570081
1747+a, gdbSNP:200099073
1771+c, tdbSNP:114700049
1772+a, gdbSNP:147474296
1777+a, gdbSNP:386572907
complement(1777)-g, adbSNP:2734848
1802+a, gdbSNP:372461990
1807+a, cdbSNP:376080076
1832+c, tdbSNP:370450329
1840+c, tdbSNP:373856752
1842+c, gdbSNP:368013869
1853+g, tdbSNP:113005509
1864+a, cdbSNP:375817372
complement(1873)-g, adbSNP:2587553
1875+a, gdbSNP:267602698
1878+c, tdbSNP:55787008
1881+c, tdbSNP:7104979
1903+g, tdbSNP:376195155
1958+c, tdbSNP:201856441
1998+a, gdbSNP:150627679
2001+a, cdbSNP:375251188
2013+c, tdbSNP:139195339
2052+a, gdbSNP:55849504
2063+c, tdbSNP:202222056
2092+a, gdbSNP:189187004
2102+a, gdbSNP:56006094
2103+c, gdbSNP:201092692
2126+c, gdbSNP:200745528
2131+a, gdbSNP:17115461
2140+c, tdbSNP:368854368
2147+a, gdbSNP:373202169
2152+c, tdbSNP:77077463
2155+a, cdbSNP:370756598
2156+c, tdbSNP:192587080
2157+a, gdbSNP:377621768
2167+g, tdbSNP:200344768
2180+a, gdbSNP:146480879
2192+a, gdbSNP:374434021
2209+a, tdbSNP:368972146
2213+a, gdbSNP:371374955
complement(2231)-t, cdbSNP:1800497
2239+c, tdbSNP:367992103
2251+c, tdbSNP:371542276
2267+a, gdbSNP:374980288
2269+c, tdbSNP:79635225
2271+c, gdbSNP:369403733
2276+c, tdbSNP:371927986
2286+c, tdbSNP:373359910
2292+g, tdbSNP:375843671
2300+c, tdbSNP:201580434
2301+a, gdbSNP:376599631
2308+a, gdbSNP:139904975
2407+c, gdbSNP:375875018
2428+a, tdbSNP:143395565
complement(2468)-c, adbSNP:2734847
Gene SymbolANKK1
Gene SynonymPKK2
Chromosome11
Locus Map11q23.2
Title The effect of selected polymorphisms of the dopamine receptor gene DRD2 and the ANKK-1 on the preference of concentrations of sucrose solutions in men with alcohol dependence .
Author Jablonski M, Jasiewicz A, Kucharska-Mazur J, Samochowiec J, Bienkowski P, Mierzejewski P and Samochowiec A.
Journal Psychiatr Danub 25 (4), 371-378 (2013)
Title A pilot study of genetic variants in dopamine regulators with indoor tanning and melanoma .
Author Flores KG, Erdei E, Luo L, White KA, Leng S, Berwick M and Lazovich D.
Journal Exp. Dermatol. 22 (9), 576-581 (2013)
Title Multivariate analysis of dopaminergic gene variants as risk factors of heroin dependence .
Author Vereczkei A, Demetrovics Z, Szekely A, Sarkozy P, Antal P, Szilagyi A, Sasvari-Szekely M and Barta C.
Journal PLoS ONE 8 (6), E66592 (2013)
Title Associations of prenatal nicotine exposure and the dopamine related genes ANKK1 and DRD2 to verbal language .
Author Eicher JD, Powers NR, Cho K, Miller LL, Mueller KL, Ring SM, Tomblin JB and Gruen JR.
Journal PLoS ONE 8 (5), E63762 (2013)
Title Dopamine D2 receptor and ankyrin repeat and kinase domain containing 1 genes among the two linguistically distinct tribal populations of Ranchi district, Jharkhand, India .
Author Sachdeva MP, Saksena D, Mondal PR, Meitei SY and Saraswathy KN.
Journal Anthropol Anz 70 (1), 15-26 (2013)
Title Identification and characterization of ANKK1: a novel kinase gene closely linked to DRD2 on chromosome band 11q23.1 .
Author Neville MJ, Johnstone EC and Walton RT.
Journal Hum. Mutat. 23 (6), 540-545 (2004)
Title Lack of association in Japanese patients between neuroleptic malignant syndrome and the TaqI A polymorphism of the dopamine D2 receptor gene .
Author Kishida I, Kawanishi C, Furuno T, Matsumura T, Hasegawa H, Sugiyama N, Suzuki K, Yamada Y and Kosaka K.
Journal Psychiatr. Genet. 13 (1), 55-57 (2003)
Title Relationship between functional dopamine D2 and D3 receptors gene polymorphisms and neuroleptic malignant syndrome .
Author Mihara K, Kondo T, Suzuki A, Yasui-Furukori N, Ono S, Sano A, Koshiro K, Otani K and Kaneko S.
Journal Am. J. Med. Genet. B Neuropsychiatr. Genet. 117B (1), 57-60 (2003)
Title The protein kinase complement of the human genome .
Author Manning G, Whyte DB, Martinez R, Hunter T and Sudarsanam S.
Journal Science 298 (5600), 1912-1934 (2002)
Title Dopamine DRD2 Taq I polymorphism associates with caudate nucleus volume and cognitive performance in memory impaired subjects .
Author Bartres-Faz D, Junque C, Serra-Grabulosa JM, Lopez-Alomar A, Moya A, Bargallo N, Mercader JM, Moral P and Clemente IC.
Journal Neuroreport 13 (9), 1121-1125 (2002)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.