• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ankyrin repeat and kinase domain containing 1 (ANKK1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_178510 Homo sapiens ankyrin repeat and kinase domain containing 1 (ANKK1), mRNA. GenEZ ORF Cloning On-demand $849.00 20

*Business Day

Related Services

RefSeq Version NM_178510.1, 30425443
Length 2543 bp
Structure linear
Update Date 18-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens ankyrin repeat and kinase domain containing 1 (ANKK1), mRNA.
Product ankyrin repeat and protein kinase domain-containing protein 1
Comment

Summary: The protein encoded by this gene belongs to the Ser/Thr protein kinase family, and protein kinase superfamily involved in signal transduction pathways. This gene is closely linked to DRD2 gene (GeneID:1813) on chr 11, and a well studied restriction fragment length polymorphism (RFLP) designated TaqIA, was originally associated with the DRD2 gene, however, later was determined to be located in exon 8 of ANKK1 gene (PMIDs: 18621654, 15146457), where it causes a nonconservative amino acid substitution. It is not clear if this gene plays any role in neuropsychiatric disorders previously associated with Taq1A RFLP. [provided by RefSeq, Sep 2009].

RefSeq NP_848605.1
CDS 95..2392
Misc Feature(1)170..937
Misc Feature(2)170..937
Misc Feature(3)182..937
Misc Feature(4)order(182..190,200..202,239..241,245..247,344..346,
Misc Feature(5)order(182..190,200..202,239..241,245..247,344..346,
Misc Feature(6)order(188..190,407..409,413..415,527..529,533..535,
Misc Feature(7)order(578..598,650..661)
Misc Feature(8)1175..1264
Misc Feature(9)1190..1465
Misc Feature(10)1259..1633
Misc Feature(11)1274..1363
Misc Feature(12)1373..1462
Misc Feature(13)1388..1663
Misc Feature(14)1472..1561
Misc Feature(15)1556..1930
Misc Feature(16)1571..1660
Misc Feature(17)1670..1759
Misc Feature(18)1685..1948
Misc Feature(19)1769..1858
Misc Feature(20)1868..1957
Misc Feature(21)1871..2230
Misc Feature(22)1883..2161
Misc Feature(23)1967..2056
Misc Feature(24)2066..2155
Misc Feature(25)2126..2290
Misc Feature(26)2165..2254
Misc Feature(27)2264..2353
Exon (1)1..279
Gene:ANKK1
Gene Synonym:PKK2
Exon (2)280..574
Gene:ANKK1
Gene Synonym:PKK2
Exon (3)575..726
Gene:ANKK1
Gene Synonym:PKK2
Exon (4)727..776
Gene:ANKK1
Gene Synonym:PKK2
Exon (5)777..932
Gene:ANKK1
Gene Synonym:PKK2
Exon (6)933..1051
Gene:ANKK1
Gene Synonym:PKK2
Exon (7)1052..1088
Gene:ANKK1
Gene Synonym:PKK2
Exon (8)1089..2543
Gene:ANKK1
Gene Synonym:PKK2
Translation MAADPTELRLGSLPVFTRDDFEGDWRLVASGGFSQVFQARHRRWRTEYAIKCAPCLPPDA ASSDVNYLIEEAAKMKKIKFQHIVSIYGVCKQPLGIVMEFMANGSLEKVLSTHSLCWKLR FRIIHETSLAMNFLHSIKPPLLHLDLKPGNILLDSNMHVKISDFGLSKWMEQSTRMQYIE RSALRGMLSYIPPEMFLESNKAPGPKYDVYSFAIVIWELLTQKKPYSGFNMMMIIIRVAA GMRPSLQPVSDQWPSEAQQMVDLMKRCWDQDPKKRPCFLDITIETDILLSLLQSRVAVPE SKALARKVSCKLSLRQPGEVNEDISQELMDSDSGNYLKRALQLSDRKNLVPRDEELCIYE NKVTPLHFLVAQGSVEQVRLLLAHEVDVDCQTASGYTPLLIAAQDQQPDLCALLLAHGAD ANRVDEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQEREGWTPLHLAAQNNFENVARLL VSRQADPNLHEAEGKTPLHVAAYFGHVSLVKLLTSQGAELDAQQRNLRTPLHLAVERGKV RAIQHLLKSGAVPDALDQSGYGPLHTAAARGKYLICKMLLRYGASLELPTHQGWTPLHLA AYKGHLEIIHLLAESHANMGALGAVNWTPLHLAARHGEEAVVSALLQCGADPNAAEQSGW TPLHLAVQRSTFLSVINLLEHHANVHARNKVGWTPAHLAALKGNTAILKVLVEAGAQLDV QDGVSCTPLQLALRSRKQGIMSFLEGKEPSVATLGGSKPGAEMEI
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
51+dbSNP:
51+a, cdbSNP:111334073
104+g, tdbSNP:35657708
185..186+, gdbSNP:142610545
207+a, tdbSNP:201008406
250+c, gdbSNP:111789052
275+a, gdbSNP:181883517
321+dbSNP:
321+a, gdbSNP:201185165
343+c, tdbSNP:201933022
349+c, tdbSNP:17115439
356+a, gdbSNP:201291015
415+c, gdbSNP:200273061
425+c, tdbSNP:77948690
459+a, gdbSNP:35877321
498+a, cdbSNP:202206437
501+a, gdbSNP:199783502
511+a, gdbSNP:201489078
537+c, tdbSNP:200103052
544+c, tdbSNP:58224139
547+a, cdbSNP:4938013
591+dbSNP:
591+g, tdbSNP:141919233
632+a, gdbSNP:150678579
640+a, gdbSNP:140803658
648+a, gdbSNP:115800217
783+dbSNP:
783+a, cdbSNP:200624485
801+c, tdbSNP:201608349
803+c, tdbSNP:56047699
804+a, gdbSNP:199582150
809+a, gdbSNP:7118900
810+c, tdbSNP:190009110
851+c, tdbSNP:201098042
918+a, gdbSNP:146498786
921+c, tdbSNP:35488601
934+dbSNP:
934+a, cdbSNP:138608171
944+a, gdbSNP:45466992
978+g, tdbSNP:199747130
1037+c, tdbSNP:114931186
1046+a, gdbSNP:11604671
1122+dbSNP:
1122+c, tdbSNP:202009146
1127+a, gdbSNP:139270089
1128+a, gdbSNP:199662373
1130+c, tdbSNP:201257762
1145+c, tdbSNP:186633697
1190+c, tdbSNP:56339158
1195+a, cdbSNP:34298987
1220+a, gdbSNP:56299709
1255+c, tdbSNP:17115457
1310+c, gdbSNP:200699123
1370+a, gdbSNP:55699907
1417+c, tdbSNP:199986656
1418+c, gdbSNP:4938016
1427+c, tdbSNP:78229381
1428+a, gdbSNP:201891002
1436+a, gdbSNP:2587555
1444+c, tdbSNP:56005821
1445+a, gdbSNP:34983219
1467+a, gdbSNP:184645039
1527+a, gdbSNP:200848862
1563+c, tdbSNP:2734849
1567+c, gdbSNP:199896606
1581+a, cdbSNP:201207634
1581+, cdbSNP:200507206
1582+c, tdbSNP:200848219
1628+g, tdbSNP:2587554
1663+c, gdbSNP:199570081
1747+a, gdbSNP:200099073
1771+c, tdbSNP:114700049
1772+a, gdbSNP:147474296
1777+a, gdbSNP:2734848
1853+g, tdbSNP:113005509
1873+a, gdbSNP:2587553
1878+c, tdbSNP:55787008
1881+c, tdbSNP:7104979
1912..1913+, gadbSNP:10599741
1958+c, tdbSNP:201856441
1998+a, gdbSNP:150627679
2013+c, tdbSNP:139195339
2052+a, gdbSNP:55849504
2063+c, tdbSNP:202222056
2092+a, gdbSNP:189187004
2100+, gdbSNP:67430427
2102+a, gdbSNP:56006094
2103+c, gdbSNP:201092692
2126+c, gdbSNP:200745528
2131..2132+, gadbSNP:10615370
2131+a, gdbSNP:17115461
2152+c, tdbSNP:77077463
2156+c, tdbSNP:192587080
2167+g, tdbSNP:200344768
2180+a, gdbSNP:146480879
2231+c, tdbSNP:1800497
2269+c, tdbSNP:79635225
2300+c, tdbSNP:201580434
2308+a, gdbSNP:139904975
2428+a, tdbSNP:143395565
2468+a, cdbSNP:2734847
Gene SymbolANKK1
Gene SynonymPKK2
Chromosome11
Locus Map11q23.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_178510 Homo sapiens ankyrin repeat and kinase domain containing 1 (ANKK1), mRNA. On-demand $849.00 20
Title DRD2/ANKK1 TaqI A genotype moderates the relationship between alexithymia and the relative value of alcohol among male college binge drinkers .
Author Wahlstrom,L.C., McChargue,D.E. and Mackillop,J.
Journal Pharmacol. Biochem. Behav. 102 (3), 471-476 (2012)
Title DRD2/ANKK1 TaqIA and SLC6A3 VNTR polymorphisms in alcohol dependence: association and gene-gene interaction study in a population of Central Italy .
Author Mignini,F., Napolioni,V., Codazzo,C., Carpi,F.M., Vitali,M., Romeo,M. and Ceccanti,M.
Journal Neurosci. Lett. 522 (2), 103-107 (2012)
Title Pharmacogenomic associations with weight gain in olanzapine treatment of patients without schizophrenia .
Author Houston,J.P., Kohler,J., Bishop,J.R., Ellingrod,V.L., Ostbye,K.M., Zhao,F., Conley,R.R., Poole Hoffmann,V. and Fijal,B.A.
Journal J Clin Psychiatry 73 (8), 1077-1086 (2012)
Title A DRD2 and ANKK1 haplotype is associated with nicotine dependence .
Author Voisey,J., Swagell,C.D., Hughes,I.P., van Daal,A., Noble,E.P., Lawford,B.R., Young,R.M. and Morris,C.P.
Journal Psychiatry Res 196 (2-3), 285-289 (2012)
Title [ANKK1 gene in psychiatry] .
Author Suchanecka,A., Grzywacz,A. and Samochowiec,J.
Journal Psychiatr. Pol. 45 (3), 349-356 (2011)
Title Identification and characterization of ANKK1: a novel kinase gene closely linked to DRD2 on chromosome band 11q23.1 .
Author Neville,M.J., Johnstone,E.C. and Walton,R.T.
Journal Hum. Mutat. 23 (6), 540-545 (2004)
Title Lack of association in Japanese patients between neuroleptic malignant syndrome and the TaqI A polymorphism of the dopamine D2 receptor gene .
Author Kishida,I., Kawanishi,C., Furuno,T., Matsumura,T., Hasegawa,H., Sugiyama,N., Suzuki,K., Yamada,Y. and Kosaka,K.
Journal Psychiatr. Genet. 13 (1), 55-57 (2003)
Title Relationship between functional dopamine D2 and D3 receptors gene polymorphisms and neuroleptic malignant syndrome .
Author Mihara,K., Kondo,T., Suzuki,A., Yasui-Furukori,N., Ono,S., Sano,A., Koshiro,K., Otani,K. and Kaneko,S.
Journal Am. J. Med. Genet. B Neuropsychiatr. Genet. 117B (1), 57-60 (2003)
Title The protein kinase complement of the human genome .
Author Manning,G., Whyte,D.B., Martinez,R., Hunter,T. and Sudarsanam,S.
Journal Science 298 (5600), 1912-1934 (2002)
Title Dopamine DRD2 Taq I polymorphism associates with caudate nucleus volume and cognitive performance in memory impaired subjects .
Author Bartres-Faz,D., Junque,C., Serra-Grabulosa,J.M., Lopez-Alomar,A., Moya,A., Bargallo,N., Mercader,J.M., Moral,P. and Clemente,I.C.
Journal Neuroreport 13 (9), 1121-1125 (2002)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.