• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens phosphoinositide-3-kinase, regulatory subunit 1 (alpha) (PIK3R1), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_181523 Homo sapiens phosphoinositide-3-kinase, regulatory subunit 1 (alpha) (PIK3R1), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $849.00 20

*Business Day

Related Services

RefSeq Version NM_181523.2, 335057530
Length 6991 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens phosphoinositide-3-kinase, regulatory subunit 1 (alpha) (PIK3R1), transcript variant 1, mRNA.
Product phosphatidylinositol 3-kinase regulatory subunit alpha isoform 1
Comment

Summary: Phosphatidylinositol 3-kinase phosphorylates the inositol ring of phosphatidylinositol at the 3-prime position. The enzyme comprises a 110 kD catalytic subunit and a regulatory subunit of either 85, 55, or 50 kD. This gene encodes the 85 kD regulatory subunit. Phosphatidylinositol 3-kinase plays an important role in the metabolic actions of insulin, and a mutation in this gene has been associated with insulin resistance. Alternative splicing of this gene results in four transcript variants encoding different isoforms. [provided by RefSeq, Jun 2011].


Transcript Variant: This variant (1) encodes the longest isoform (1) of this protein.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_852664.1
CDS 581..2755
Misc Feature(1)521..523
Misc Feature(2)593..814
Misc Feature(3)593..814
Misc Feature(4)order(614..622,632..634,641..643,737..745,788..790,
Misc Feature(5)920..1486
Misc Feature(6)965..1465
Misc Feature(7)order(1031..1033,1139..1141,1151..1153,1367..1369,
Misc Feature(8)1031..1033
Misc Feature(9)1553..1885
Misc Feature(10)order(1598..1600,1652..1654,1718..1720,1724..1726)
Misc Feature(11)1682..1684
Misc Feature(12)1682..1684
Misc Feature(13)order(1721..1723,1802..1804)
Misc Feature(14)1934..1936
Misc Feature(15)1979..1981
Misc Feature(16)2246..2248
Misc Feature(17)2318..2320
Misc Feature(18)2318..2320
Misc Feature(19)2399..2401
Misc Feature(20)2402..2404
Misc Feature(21)2402..2404
Misc Feature(22)2429..2740
Misc Feature(23)2462..2464
Misc Feature(24)2465..2467
Misc Feature(25)order(2471..2473,2525..2527,2531..2536,2585..2587,
Misc Feature(26)order(2588..2590,2621..2623,2687..2689,2696..2698,
Misc Feature(27)2642..2644
Exon (1)1..194
Gene:PIK3R1
Gene Synonym:GRB1; p85; p85-ALPHA
Exon (2)195..914
Gene:PIK3R1
Gene Synonym:GRB1; p85; p85-ALPHA
Exon (3)915..1007
Gene:PIK3R1
Gene Synonym:GRB1; p85; p85-ALPHA
Exon (4)1008..1082
Gene:PIK3R1
Gene Synonym:GRB1; p85; p85-ALPHA
Exon (5)1083..1214
Gene:PIK3R1
Gene Synonym:GRB1; p85; p85-ALPHA
Exon (6)1215..1416
Gene:PIK3R1
Gene Synonym:GRB1; p85; p85-ALPHA
Exon (7)1417..1496
Gene:PIK3R1
Gene Synonym:GRB1; p85; p85-ALPHA
Exon (8)1497..1599
Gene:PIK3R1
Gene Synonym:GRB1; p85; p85-ALPHA
Exon (9)1600..1698
Gene:PIK3R1
Gene Synonym:GRB1; p85; p85-ALPHA
Exon (10)1699..1879
Gene:PIK3R1
Gene Synonym:GRB1; p85; p85-ALPHA
Exon (11)1880..2005
Gene:PIK3R1
Gene Synonym:GRB1; p85; p85-ALPHA
Exon (12)2006..2148
Gene:PIK3R1
Gene Synonym:GRB1; p85; p85-ALPHA
Exon (13)2149..2325
Gene:PIK3R1
Gene Synonym:GRB1; p85; p85-ALPHA
Exon (14)2326..2394
Gene:PIK3R1
Gene Synonym:GRB1; p85; p85-ALPHA
Exon (15)2395..2565
Gene:PIK3R1
Gene Synonym:GRB1; p85; p85-ALPHA
Exon (16)2566..6975
Gene:PIK3R1
Gene Synonym:GRB1; p85; p85-ALPHA
Translation MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYN ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEADVEQQALTLPDLAE QFAPPDIAPPLLIKLVEAIEKKGLECSTLYRTQSSSNLAELRQLLDCDTPSVDLEMIDVH VLADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTL QYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNE RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKL DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMK RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIID SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA QQRR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
28+dbSNP:
28+a, gdbSNP:144402052
204+dbSNP:
204+a, gdbSNP:149224952
226+a, gdbSNP:146895602
301+a, gdbSNP:59576080
332+a, gdbSNP:189826798
410+a, gdbSNP:147774029
468+g, tdbSNP:181792324
615+a, gdbSNP:142940225
645+c, tdbSNP:150689648
775+a, gdbSNP:73768883
790+a, gdbSNP:149852476
799+c, tdbSNP:706713
810+, tdbSNP:67089770
848+c, tdbSNP:141974044
886+a, gdbSNP:144275585
967+dbSNP:
967+a, gdbSNP:201402919
1024+dbSNP:
1024+c, tdbSNP:147805531
1094+dbSNP:
1094+a, gdbSNP:112487959
1106+a, gdbSNP:200820769
1112+a, gdbSNP:141319498
1121+a, gdbSNP:143572224
1143+a, gdbSNP:148059720
1201+c, tdbSNP:61749601
1217+dbSNP:
1217+a, gdbSNP:150170197
1266+c, gdbSNP:201598843
1267+c, tdbSNP:34175949
1296+c, tdbSNP:141981005
1312+, adbSNP:67190304
1327+c, gdbSNP:147303522
1379+a, gdbSNP:146327549
1400+a, gdbSNP:55896055
1533+dbSNP:
1533+c, tdbSNP:200276601
1540+c, tdbSNP:201809898
1541+a, gdbSNP:142439210
1544+a, gdbSNP:147541581
1558+a, gdbSNP:3730089
1617+dbSNP:
1617+a, gdbSNP:111615871
1636+c, tdbSNP:144238662
1649+g, tdbSNP:147795824
1730+dbSNP:
1730+, tdbSNP:67842735
1750+c, tdbSNP:17847317
1756+c, tdbSNP:3730090
1765+a, gdbSNP:149905863
1783+a, gdbSNP:200107048
1869+a, cdbSNP:188617536
1899+dbSNP:
1899+a, cdbSNP:3730091
1931+a, gdbSNP:17852841
2104+dbSNP:
2104+c, tdbSNP:144980948
2182..2183+dbSNP:
2182..2183+, adbSNP:68169488
2245+c, gdbSNP:200936785
2308+a, gdbSNP:149090706
2422+dbSNP:
2422+a, tdbSNP:189960237
2500+a, gdbSNP:61749602
2505+a, gdbSNP:143171832
2519+a, cdbSNP:193921079
2572+dbSNP:
2572+c, tdbSNP:114163757
2575+c, tdbSNP:201618039
2679+a, gdbSNP:112146342
2689+c, tdbSNP:3729981
2758+c, tdbSNP:41268435
2759+a, gdbSNP:201345202
2866+a, tdbSNP:1043425
2871+c, tdbSNP:1043426
2965+a, gdbSNP:148128862
3059+a, g, tdbSNP:56392116
3066+a, gdbSNP:3729982
3108+a, gdbSNP:3729983
3236+a, gdbSNP:116483958
3320+a, gdbSNP:3729984
3557+c, tdbSNP:188971814
3559+, cdbSNP:5868531
3629+c, tdbSNP:56235611
3650+a, gdbSNP:1043526
3725..3726+, adbSNP:36055833
3726..3727+, adbSNP:33943986
3773+c, tdbSNP:138547786
3802+a, gdbSNP:55922411
3803+c, tdbSNP:73771048
3888..3889+, adbSNP:200582275
3971+a, gdbSNP:141513458
3994..3995+, aaagdbSNP:148102971
4057+a, cdbSNP:2544847
4322+c, gdbSNP:79515688
4497..4498+, acdbSNP:70937069
4499..4500+, tgdbSNP:142718023
4499+, tgdbSNP:58984754
4566..4568+, atcdbSNP:146378195
4588+a, gdbSNP:202050841
4588+, gdbSNP:111804580
4728+a, gdbSNP:146222065
4734+a, gdbSNP:184402750
4746..4747+, cdbSNP:34570857
4757+c, tdbSNP:79397497
4835+a, cdbSNP:17253369
4859+g, tdbSNP:1643545
4865+a, tdbSNP:59812921
4902+g, tdbSNP:187593797
5036+a, gdbSNP:191632399
5069+g, tdbSNP:149896188
5071+a, c, tdbSNP:76752856
5111+c, tdbSNP:7722222
5187+a, cdbSNP:12755
5292+a, gdbSNP:184219703
5331+c, g, tdbSNP:7702655
5357+c, tdbSNP:188842732
5414+a, gdbSNP:3756668
5456+c, tdbSNP:115218343
5474+c, tdbSNP:111602460
5483+a, gdbSNP:113647997
5532+c, tdbSNP:80193740
5665+a, gdbSNP:184450939
5691+c, tdbSNP:75107789
5700+a, cdbSNP:190565418
5736+a, cdbSNP:148652684
5852+a, gdbSNP:182172182
5937+c, tdbSNP:185744723
5983+a, gdbSNP:188947044
6031+g, tdbSNP:7707793
6233+a, gdbSNP:142246069
6257+a, gdbSNP:77975365
6259+c, tdbSNP:66666989
6332+a, gdbSNP:79873509
6351+c, tdbSNP:181054297
6496..6499+, ctatdbSNP:144355571
6496..6497+, tadbSNP:5868532
6497..6498+, tadbSNP:34873643
6498..6499+, atatatdbSNP:71872022
6500..6503+, atatdbSNP:10612198
6521..6530+, tgtgtgtgtgdbSNP:10583550
6521..6522+, tdbSNP:34491401
6522+c, tdbSNP:1103100
6524..6529+, gtgtgtdbSNP:71726243
6524..6527+, gtgtdbSNP:71747811
6524+, gdbSNP:35033772
6539..6562+, tgtgtgtgtatatatatatatatadbSNP:72416703
6545..6554+, tgtatatatadbSNP:71783229
6546+c, tdbSNP:1643544
6547..6554+, tatatatadbSNP:71741785
6547..6548+, tadbSNP:10612200
6548..6555+, atatatatdbSNP:34870423
6548..6551+, atatdbSNP:71655141
6548..6549+, atdbSNP:71774715
6548+a, gdbSNP:4016109
6549..6554+a, gdbSNP:10612199
6549..6554+, tatatadbSNP:72018004
6551..6558+, tatatatadbSNP:71663148
6552..6557+, atatatdbSNP:70987200
6566+a, gdbSNP:7708232
6578+a, gdbSNP:9687422
6586+a, gdbSNP:1131952
6588+a, gdbSNP:201899089
6590..6591+, gtgtgtdbSNP:35243561
6593..6596+, tgtadbSNP:10612201
6595..6596+, gtgtgtdbSNP:10669997
6598+a, gdbSNP:7712114
6604+a, tdbSNP:113204864
6606+a, gdbSNP:9687539
6610+a, gdbSNP:7712540
6613..6614+a, gdbSNP:9686376
6614+a, gdbSNP:7712126
6626+a, gdbSNP:9687541
6647..6648+, tgdbSNP:200723585
6647+a, gdbSNP:9623
6649+a, gdbSNP:2591417
6651+a, gdbSNP:2545411
6656+a, gdbSNP:142367296
6656+c, tdbSNP:1071660
6659..6662+, tatgdbSNP:202034227
6668+a, tdbSNP:185430778
6679+a, cdbSNP:78046963
6680..6681+g, tdbSNP:1643543
6681+a, cdbSNP:1664560
6682+, adbSNP:200255602
6790+c, gdbSNP:191301115
6792+, gdbSNP:145705543
6885+g, tdbSNP:75047256
Gene SymbolPIK3R1
Gene SynonymGRB1; p85; p85-ALPHA
Chromosome5
Locus Map5q13.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001242466 Homo sapiens phosphoinositide-3-kinase, regulatory subunit 1 (alpha) (PIK3R1), transcript variant 4, mRNA. In-stock $418.00 $369.00 10
NM_181504 Homo sapiens phosphoinositide-3-kinase, regulatory subunit 1 (alpha) (PIK3R1), transcript variant 2, mRNA. On-demand $699.00 18
NM_181523 Homo sapiens phosphoinositide-3-kinase, regulatory subunit 1 (alpha) (PIK3R1), transcript variant 1, mRNA. On-demand $849.00 20
NM_181524 Homo sapiens phosphoinositide-3-kinase, regulatory subunit 1 (alpha) (PIK3R1), transcript variant 3, mRNA. On-demand $699.00 18
Title Molecular mechanism behind rotavirus NSP1-mediated PI3 kinase activation: interaction between NSP1 and the p85 subunit of PI3 kinase .
Author Bagchi,P., Nandi,S., Nayak,M.K. and Chawla-Sarkar,M.
Journal J. Virol. 87 (4), 2358-2362 (2013)
Title Erufosine suppresses breast cancer in vitro and in vivo for its activity on PI3K, c-Raf and Akt proteins .
Author Dineva,I.K., Zaharieva,M.M., Konstantinov,S.M., Eibl,H. and Berger,M.R.
Journal J. Cancer Res. Clin. Oncol. 138 (11), 1909-1917 (2012)
Title Protein phosphatase 1 regulatory subunit 12A and catalytic subunit delta, new members in the phosphatidylinositide 3 kinase insulin-signaling pathway .
Author Geetha,T., Langlais,P., Caruso,M. and Yi,Z.
Journal J. Endocrinol. 214 (3), 437-443 (2012)
Title miR-376a suppresses proliferation and induces apoptosis in hepatocellular carcinoma .
Author Zheng,Y., Yin,L., Chen,H., Yang,S., Pan,C., Lu,S., Miao,M. and Jiao,B.
Journal FEBS Lett. 586 (16), 2396-2403 (2012)
Title Multi-level targeting of the phosphatidylinositol-3-kinase pathway in non-small cell lung cancer cells .
Author Zito,C.R., Jilaveanu,L.B., Anagnostou,V., Rimm,D., Bepler,G., Maira,S.M., Hackl,W., Camp,R., Kluger,H.M. and Chao,H.H.
Journal PLoS ONE 7 (2), E31331 (2012)
Title Agonist-induced association of the p21ras GTPase-activating protein with phosphatidylinositol 3-kinase .
Author Sjolander,A. and Lapetina,E.G.
Journal Biochem. Biophys. Res. Commun. 189 (3), 1503-1508 (1992)
Title Insulin and insulinomimetic agents induce activation of phosphatidylinositol 3'-kinase upon its association with pp185 (IRS-1) in intact rat livers .
Author Hadari,Y.R., Tzahar,E., Nadiv,O., Rothenberg,P., Roberts,C.T. Jr., LeRoith,D., Yarden,Y. and Zick,Y.
Journal J. Biol. Chem. 267 (25), 17483-17486 (1992)
Title Regulated coupling of the Neu receptor to phosphatidylinositol 3'-kinase and its release by oncogenic activation .
Author Peles,E., Lamprecht,R., Ben-Levy,R., Tzahar,E. and Yarden,Y.
Journal J. Biol. Chem. 267 (17), 12266-12274 (1992)
Title Chromosomal localization of human p85 alpha, a subunit of phosphatidylinositol 3-kinase, and its homologue p85 beta .
Author Volinia,S., Patracchini,P., Otsu,M., Hiles,I., Gout,I., Calzolari,E., Bernardi,F., Rooke,L. and Waterfield,M.D.
Journal Oncogene 7 (4), 789-793 (1992)
Title SH2 domains of the p85 alpha subunit of phosphatidylinositol 3-kinase regulate binding to growth factor receptors .
Author McGlade,C.J., Ellis,C., Reedijk,M., Anderson,D., Mbamalu,G., Reith,A.D., Panayotou,G., End,P., Bernstein,A., Kazlauskas,A. et al.
Journal Mol. Cell. Biol. 12 (3), 991-997 (1992)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.