• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens phosphoinositide-3-kinase, regulatory subunit 1 (alpha) (PIK3R1), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu21143 Homo sapiens phosphoinositide-3-kinase, regulatory subunit 1 (alpha) (PIK3R1), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu21143C Homo sapiens phosphoinositide-3-kinase, regulatory subunit 1 (alpha) (PIK3R1), transcript variant 1, mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_181523.2, 335057530
Length 2175 bp
Structure linear
Update Date 05-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens phosphoinositide-3-kinase, regulatory subunit 1 (alpha) (PIK3R1), transcript variant 1, mRNA.
Product phosphatidylinositol 3-kinase regulatory subunit alpha isoform 1
Comment

Summary: Phosphatidylinositol 3-kinase phosphorylates the inositol ring of phosphatidylinositol at the 3-prime position. The enzyme comprises a 110 kD catalytic subunit and a regulatory subunit of either 85, 55, or 50 kD. This gene encodes the 85 kD regulatory subunit. Phosphatidylinositol 3-kinase plays an important role in the metabolic actions of insulin, and a mutation in this gene has been associated with insulin resistance. Alternative splicing of this gene results in four transcript variants encoding different isoforms. [provided by RefSeq, Jun 2011].


Transcript Variant: This variant (1) encodes the longest isoform (1) of this protein.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_852664.1
CDS 581..2755
Misc Feature(1)521..523
Misc Feature(2)584..586
Misc Feature(3)584..586
Misc Feature(4)593..817
Misc Feature(5)order(614..622,632..634,641..643,737..745,788..790,
Misc Feature(6)920..1486
Misc Feature(7)order(1031..1033,1139..1141,1151..1153,1367..1369,
Misc Feature(8)1031..1033
Misc Feature(9)1553..1885
Misc Feature(10)order(1598..1600,1652..1654,1718..1720,1724..1726)
Misc Feature(11)1682..1684
Misc Feature(12)1682..1684
Misc Feature(13)order(1721..1723,1802..1804)
Misc Feature(14)1898..2380
Misc Feature(15)1934..1936
Misc Feature(16)order(1967..1969,1979..1981,1988..1990,2021..2029,
Misc Feature(17)1979..1981
Misc Feature(18)2246..2248
Misc Feature(19)2318..2320
Misc Feature(20)2318..2320
Misc Feature(21)2399..2401
Misc Feature(22)2402..2404
Misc Feature(23)2402..2404
Misc Feature(24)2429..2740
Misc Feature(25)2462..2464
Misc Feature(26)2465..2467
Misc Feature(27)order(2471..2473,2525..2527,2531..2536,2585..2587,
Misc Feature(28)order(2588..2590,2621..2623,2687..2689,2696..2698,
Misc Feature(29)2642..2644
Exon (1)1..194
Gene:PIK3R1
Gene Synonym:AGM7; GRB1; p85; p85-ALPHA
Exon (2)195..914
Gene:PIK3R1
Gene Synonym:AGM7; GRB1; p85; p85-ALPHA
Exon (3)915..1007
Gene:PIK3R1
Gene Synonym:AGM7; GRB1; p85; p85-ALPHA
Exon (4)1008..1082
Gene:PIK3R1
Gene Synonym:AGM7; GRB1; p85; p85-ALPHA
Exon (5)1083..1214
Gene:PIK3R1
Gene Synonym:AGM7; GRB1; p85; p85-ALPHA
Exon (6)1215..1416
Gene:PIK3R1
Gene Synonym:AGM7; GRB1; p85; p85-ALPHA
Exon (7)1417..1496
Gene:PIK3R1
Gene Synonym:AGM7; GRB1; p85; p85-ALPHA
Exon (8)1497..1599
Gene:PIK3R1
Gene Synonym:AGM7; GRB1; p85; p85-ALPHA
Exon (9)1600..1698
Gene:PIK3R1
Gene Synonym:AGM7; GRB1; p85; p85-ALPHA
Exon (10)1699..1879
Gene:PIK3R1
Gene Synonym:AGM7; GRB1; p85; p85-ALPHA
Exon (11)1880..2005
Gene:PIK3R1
Gene Synonym:AGM7; GRB1; p85; p85-ALPHA
Exon (12)2006..2148
Gene:PIK3R1
Gene Synonym:AGM7; GRB1; p85; p85-ALPHA
Exon (13)2149..2325
Gene:PIK3R1
Gene Synonym:AGM7; GRB1; p85; p85-ALPHA
Exon (14)2326..2394
Gene:PIK3R1
Gene Synonym:AGM7; GRB1; p85; p85-ALPHA
Exon (15)2395..2565
Gene:PIK3R1
Gene Synonym:AGM7; GRB1; p85; p85-ALPHA
Exon (16)2566..6975
Gene:PIK3R1
Gene Synonym:AGM7; GRB1; p85; p85-ALPHA
Translation MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYN ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEADVEQQALTLPDLAE QFAPPDIAPPLLIKLVEAIEKKGLECSTLYRTQSSSNLAELRQLLDCDTPSVDLEMIDVH VLADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTL QYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNE RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKL DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMK RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIID SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA QQRR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
28+dbSNP:
28+a, gdbSNP:144402052
194+a, gdbSNP:375248510
204+dbSNP:
204+a, gdbSNP:149224952
226+a, gdbSNP:146895602
301+a, gdbSNP:59576080
332+a, gdbSNP:189826798
410+a, gdbSNP:147774029
468+g, tdbSNP:181792324
613+a, gdbSNP:372754626
645+c, tdbSNP:150689648
702+c, gdbSNP:370778654
719+a, gdbSNP:373560990
775+a, gdbSNP:73768883
790+a, gdbSNP:149852476
799+c, tdbSNP:706713
805+a, gdbSNP:367698706
848+c, tdbSNP:141974044
869+c, gdbSNP:370324792
879+a, gdbSNP:374500644
885+c, tdbSNP:368742778
910+a, gdbSNP:371843549
926+dbSNP:
926+a, cdbSNP:367923318
967+a, gdbSNP:201402919
993+c, gdbSNP:372106984
1024+dbSNP:
1024+c, tdbSNP:147805531
1094+dbSNP:
1094+a, gdbSNP:112487959
1106+a, gdbSNP:200820769
1114+c, tdbSNP:376359156
1121+a, gdbSNP:143572224
1129+c, tdbSNP:374277287
1132+c, tdbSNP:374140006
1143+a, gdbSNP:148059720
1201+c, tdbSNP:61749601
1208+c, gdbSNP:368451061
1217+dbSNP:
1217+a, gdbSNP:150170197
1236+a, gdbSNP:373220196
1266+c, gdbSNP:201598843
1267+c, tdbSNP:34175949
1296+c, tdbSNP:141981005
1327+c, gdbSNP:147303522
1333+c, tdbSNP:369338955
1379+a, gdbSNP:146327549
1400+a, gdbSNP:55896055
1405+a, cdbSNP:377030014
1473+dbSNP:
1473+a, gdbSNP:397509384
1477+c, tdbSNP:368912266
1481+c, tdbSNP:367669362
1493+c, gdbSNP:371778244
1533+dbSNP:
1533+c, tdbSNP:200276601
1540+c, tdbSNP:201809898
1541+a, gdbSNP:142439210
1544+a, gdbSNP:147541581
1558+a, gdbSNP:3730089
1558+c, tdbSNP:386584794
1617+dbSNP:
1617+a, gdbSNP:111615871
1636+c, tdbSNP:144238662
1649+g, tdbSNP:147795824
1750+dbSNP:
1750+c, tdbSNP:17847317
1756+c, tdbSNP:3730090
1765+a, gdbSNP:149905863
1783+a, gdbSNP:200107048
1869+a, c, gdbSNP:188617536
1899+dbSNP:
1899+a, cdbSNP:3730091
1931+a, gdbSNP:17852841
2045+dbSNP:
2045+a, gdbSNP:397514047
2104+c, tdbSNP:144980948
2195..2197+dbSNP:
2195..2197+, attdbSNP:397514046
2198+a, gdbSNP:374948680
2245+c, gdbSNP:200936785
2308+a, gdbSNP:149090706
2394+dbSNP:
2394+a, gdbSNP:373407418
2422+dbSNP:
2422+a, tdbSNP:189960237
2456+a, gdbSNP:377497441
2486..2487+, cdbSNP:398122385
2500+a, gdbSNP:61749602
2505+a, gdbSNP:143171832
2519+a, cdbSNP:193921079
2523..2524+, tdbSNP:398122384
2525+c, tdbSNP:397515453
2572+dbSNP:
2572+c, tdbSNP:114163757
2575+c, tdbSNP:201618039
2679+a, gdbSNP:112146342
2689+c, tdbSNP:3729981
2712+a, gdbSNP:374119964
2758+c, tdbSNP:41268435
2759+a, gdbSNP:201345202
2866+a, tdbSNP:1043425
2871+c, tdbSNP:1043426
2965+a, gdbSNP:148128862
3059+a, g, tdbSNP:56392116
3066+a, gdbSNP:3729982
3108+a, gdbSNP:3729983
3236+a, gdbSNP:116483958
3320+a, gdbSNP:3729984
3557+c, tdbSNP:188971814
3558+g, tdbSNP:374741535
3629+c, tdbSNP:56235611
3650+a, gdbSNP:1043526
3663+c, tdbSNP:373103355
3726..3727+, adbSNP:36055833
3731..3732+, adbSNP:386404033
3732..3733+, adbSNP:386404034
3737..3738+, adbSNP:372829542
3737..3738+, adbSNP:386358170
3773+c, tdbSNP:138547786
3802+a, gdbSNP:55922411
3803+c, tdbSNP:73771048
3888..3889+, adbSNP:200582275
3971+a, gdbSNP:141513458
3994..3995+, aaagdbSNP:148102971
complement(4057)-c, adbSNP:2544847
4322+c, gdbSNP:79515688
4381+, adbSNP:373752070
4497..4498+, acdbSNP:70937069
4499..4500+, tgdbSNP:58984754
4525+c, tdbSNP:375121129
4566..4568+, atcdbSNP:146378195
4588+a, gdbSNP:202050841
4588+, gdbSNP:111804580
4605+a, gdbSNP:369524767
4728+a, gdbSNP:146222065
4728+a, gdbSNP:386455481
4734+a, gdbSNP:184402750
4746..4747+, cdbSNP:34570857
4757+c, tdbSNP:79397497
4835+a, cdbSNP:17253369
4858..4859+g, tdbSNP:1643545
4859+g, tdbSNP:397832739
4865+a, tdbSNP:59812921
4902+g, tdbSNP:187593797
4927+a, gdbSNP:374269928
5000..5001+, aadbSNP:371345962
5036+a, gdbSNP:191632399
5069+g, tdbSNP:149896188
5071+a, c, tdbSNP:76752856
5111+c, tdbSNP:7722222
5187+a, cdbSNP:12755
5292+a, gdbSNP:184219703
5331+c, g, tdbSNP:7702655
5357+c, tdbSNP:188842732
5414+a, gdbSNP:3756668
5456+c, tdbSNP:115218343
5474+c, tdbSNP:111602460
5483+a, gdbSNP:113647997
5532+c, tdbSNP:80193740
5573..5575+, atgdbSNP:368136939
5665+a, gdbSNP:184450939
5691+c, tdbSNP:75107789
5700+a, cdbSNP:190565418
5736+a, cdbSNP:148652684
5773+g, tdbSNP:374472762
5852+a, gdbSNP:182172182
5880+a, gdbSNP:372795650
5937+c, tdbSNP:185744723
5983+a, gdbSNP:188947044
6031+g, tdbSNP:7707793
6233+a, gdbSNP:142246069
6257+a, gdbSNP:77975365
6259+c, tdbSNP:66666989
6332+a, gdbSNP:79873509
6351+c, tdbSNP:181054297
6496..6499+, ctatdbSNP:144355571
6519..6528+, tatgtgtgtgdbSNP:370717489
6520+a, gdbSNP:375365645
6521..6522+, tdbSNP:34491401
complement(6522)-t, cdbSNP:1103100
6524+, gdbSNP:35033772
6537..6554+, tgtgtgtgtgtatatatadbSNP:370523731
complement(6546)-t, cdbSNP:1643544
6548+a, gdbSNP:4016109
6558+a, gdbSNP:10612199
6566+a, gdbSNP:7708232
6578+a, gdbSNP:9687422
complement(6582..6587)-, atatatdbSNP:70987200
6584+a, gdbSNP:368584373
6586+a, gdbSNP:1131952
6588+a, gdbSNP:201899089
6595..6598+, tatadbSNP:367780084
6598+a, gdbSNP:7712114
6604+a, tdbSNP:113204864
6606+a, gdbSNP:9687539
6610+a, gdbSNP:7712540
6612..6613+, tgtadbSNP:367948290
6612+a, gdbSNP:9686376
6614+a, gdbSNP:7712126
6626+a, gdbSNP:9687541
6647..6648+, tgdbSNP:200723585
complement(6647)-g, adbSNP:9623
complement(6649)-g, adbSNP:2591417
complement(6651)-g, adbSNP:2545411
6656+a, gdbSNP:142367296
6659..6662+, tatgdbSNP:202034227
6668+a, tdbSNP:185430778
6679+a, cdbSNP:78046963
complement(6680..6681)-t, gdbSNP:1643543
6681+a, cdbSNP:1664560
6682+, adbSNP:200255602
6790+c, gdbSNP:191301115
6792+, gdbSNP:145705543
6843+c, gdbSNP:370076927
complement(6885)-t, gdbSNP:75047256
Gene SymbolPIK3R1
Gene SynonymAGM7; GRB1; p85; p85-ALPHA
Chromosome5
Locus Map5q13.1
Title Insulin growth factor signaling is regulated by microRNA-486, an underexpressed microRNA in lung cancer .
Author Peng Y, Dai Y, Hitchcock C, Yang X, Kassis ES, Liu L, Luo Z, Sun HL, Cui R, Wei H, Kim T, Lee TJ, Jeon YJ, Nuovo GJ, Volinia S, He Q, Yu J, Nana-Sinkam P and Croce CM.
Journal Proc. Natl. Acad. Sci. U.S.A. 110 (37), 15043-15048 (2013)
Title Mutations in PIK3R1 cause SHORT syndrome .
Author Dyment DA, Smith AC, Alcantara D, Schwartzentruber JA, Basel-Vanagaite L, Curry CJ, Temple IK, Reardon W, Mansour S, Haq MR, Gilbert R, Lehmann OJ, Vanstone MR, Beaulieu CL, Majewski J, Bulman DE, O'Driscoll M, Boycott KM and Innes AM.
Journal Am. J. Hum. Genet. 93 (1), 158-166 (2013)
Title SHORT syndrome with partial lipodystrophy due to impaired phosphatidylinositol 3 kinase signaling .
Author Chudasama KK, Winnay J, Johansson S, Claudi T, Konig R, Haldorsen I, Johansson B, Woo JR, Aarskog D, Sagen JV, Kahn CR, Molven A and Njolstad PR.
Journal Am. J. Hum. Genet. 93 (1), 150-157 (2013)
Title PIK3R1 mutations cause syndromic insulin resistance with lipoatrophy .
Author Thauvin-Robinet C, Auclair M, Duplomb L, Caron-Debarle M, Avila M, St-Onge J, Le Merrer M, Le Luyer B, Heron D, Mathieu-Dramard M, Bitoun P, Petit JM, Odent S, Amiel J, Picot D, Carmignac V, Thevenon J, Callier P, Laville M, Reznik Y, Fagour C, Nunes ML, Capeau J, Lascols O, Huet F, Faivre L, Vigouroux C and Riviere JB.
Journal Am. J. Hum. Genet. 93 (1), 141-149 (2013)
Title Integrated gene network analysis and text mining revealing PIK3R1 regulated by miR-127 in human bladder cancer .
Author Xu Y, Luo S, Liu Y, Li J, Lu Y, Jia Z, Zhao Q, Ma X, Yang M, Zhao Y, Chen P and Guo Y.
Journal Eur. J. Med. Res. 18, 29 (2013)
Title Agonist-induced association of the p21ras GTPase-activating protein with phosphatidylinositol 3-kinase .
Author Sjolander A and Lapetina EG.
Journal Biochem. Biophys. Res. Commun. 189 (3), 1503-1508 (1992)
Title Insulin and insulinomimetic agents induce activation of phosphatidylinositol 3'-kinase upon its association with pp185 (IRS-1) in intact rat livers .
Author Hadari YR, Tzahar E, Nadiv O, Rothenberg P, Roberts CT Jr, LeRoith D, Yarden Y and Zick Y.
Journal J. Biol. Chem. 267 (25), 17483-17486 (1992)
Title Regulated coupling of the Neu receptor to phosphatidylinositol 3'-kinase and its release by oncogenic activation .
Author Peles E, Lamprecht R, Ben-Levy R, Tzahar E and Yarden Y.
Journal J. Biol. Chem. 267 (17), 12266-12274 (1992)
Title Chromosomal localization of human p85 alpha, a subunit of phosphatidylinositol 3-kinase, and its homologue p85 beta .
Author Volinia S, Patracchini P, Otsu M, Hiles I, Gout I, Calzolari E, Bernardi F, Rooke L and Waterfield MD.
Journal Oncogene 7 (4), 789-793 (1992)
Title SH2 domains of the p85 alpha subunit of phosphatidylinositol 3-kinase regulate binding to growth factor receptors .
Author McGlade CJ, Ellis C, Reedijk M, Anderson D, Mbamalu G, Reith AD, Panayotou G, End P, Bernstein A and Kazlauskas A.
Journal Mol. Cell. Biol. 12 (3), 991-997 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.