• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ES cell expressed Ras (ERAS), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu07581 Homo sapiens ES cell expressed Ras (ERAS), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu07581C Homo sapiens ES cell expressed Ras (ERAS), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_181532.3, 427918076
Length 702 bp
Structure linear
Update Date 26-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens ES cell expressed Ras (ERAS), mRNA.
Product GTPase ERas precursor
Comment

Summary: This gene encodes a constitutively active member of the small GTPase Ras protein family. The encoded protein activates the phosphatidylinositol 3-kinase signal transduction pathway in undifferentiated stem cells, but is not expressed in differentiated cells. This gene may be involved in cancer and chemotherapy resistance. [provided by RefSeq, Dec 2012].

RefSeq NP_853510.1
CDS 81..782
Misc Feature(1)198..740
Misc Feature(2)204..683
Misc Feature(3)222..245
Misc Feature(4)order(225..230,369..377,381..386,396..398,405..407,
Misc Feature(5)order(228..248,276..281,297..299,372..374,531..536,
Misc Feature(6)order(243..248,288..290,294..296,312..317,354..359,
Misc Feature(7)order(267..269,273..275,300..317,327..329,339..344,
Misc Feature(8)288..314
Misc Feature(9)291..314
Misc Feature(10)297..299
Misc Feature(11)363..374
Misc Feature(12)369..425
Misc Feature(13)531..542
Misc Feature(14)order(567..572,579..581,591..593,615..617)
Misc Feature(15)621..629
Exon (1)1..37
Gene:ERAS
Gene Synonym:HRAS2; HRASP
Exon (2)38..826
Gene:ERAS
Gene Synonym:HRAS2; HRASP
Translation MELPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQ LNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVF ALDDPSSLIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVET SAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKTRHQKATCHCGCSVA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
10+dbSNP:
10+c, gdbSNP:375791982
155+c, gdbSNP:375020221
173+c, tdbSNP:111320229
224+c, tdbSNP:146098580
290+c, tdbSNP:369226473
341+g, tdbSNP:185237959
400+a, cdbSNP:371448504
434+c, tdbSNP:140112568
446+c, tdbSNP:199617160
447+a, gdbSNP:190096792
496+g, tdbSNP:143809154
506+a, c, tdbSNP:151314036
527+g, tdbSNP:61757377
533+c, tdbSNP:186911186
542+c, tdbSNP:201845858
573+a, gdbSNP:199842596
588+a, gdbSNP:373994632
602+a, gdbSNP:140653491
708+c, gdbSNP:376884818
753+a, cdbSNP:201329055
Gene SymbolERAS
Gene SynonymHRAS2; HRASP
ChromosomeX
Locus MapXp11.23
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_181532 Homo sapiens ES cell expressed Ras (ERAS), mRNA. In-stock $99.00 5-7
Title Role of the ERas gene in gastric cancer cells .
Author Liu Y, Wang Z, Li H, Wu Z, Wei F and Wang H.
Journal Oncol. Rep. 30 (1), 50-56 (2013)
Title Functional genomics identifies drivers of medulloblastoma dissemination .
Author Mumert M, Dubuc A, Wu X, Northcott PA, Chin SS, Pedone CA, Taylor
Journal Cancer Res. 72 (19), 4944-4953 (2012)
Title ERas enhances resistance to CPT-11 in gastric cancer .
Author Kubota E, Kataoka H, Tanaka M, Okamoto Y, Ebi M, Hirata Y, Murakami K, Mizoshita T, Shimura T, Mori Y, Tanida S, Kamiya T, Aoyama M, Asai K and Joh T.
Journal Anticancer Res. 31 (10), 3353-3360 (2011)
Title Identification of HLA-A*2402-restricted epitope peptide derived from ERas oncogene expressed in human scirrhous gastric cancer .
Author Iwauchi T, Tanaka H, Yamazoe S, Yashiro M, Yoshii M, Kubo N, Muguruma K, Sawada T, Ohira M and Hirakawa K.
Journal Cancer Sci. 102 (4), 683-689 (2011)
Title Detection of beta-catenin, gastrokine-2 and embryonic stem cell expressed ras in gastric cancers .
Author Zhang F, Tang JM, Wang L, Shen JY, Zheng L, Wu PP, Zhang M and Yan ZW.
Journal Int J Clin Exp Pathol 3 (8), 782-791 (2010)
Title A novel rasH2 mouse carcinogenesis model that is highly susceptible to 4-NQO-induced tongue and esophageal carcinogenesis is useful for preclinical chemoprevention studies .
Author Miyamoto S, Yasui Y, Kim M, Sugie S, Murakami A, Ishigamori-Suzuki
Journal Carcinogenesis 29 (2), 418-426 (2008)
Title ERas oncogene expression and epigenetic regulation by histone acetylation in human cancer cells .
Author Yasuda K, Yashiro M, Sawada T, Ohira M and Hirakawa K.
Journal Anticancer Res. 27 (6B), 4071-4075 (2007)
Title Human ERas gene has an upstream premature polyadenylation signal that results in a truncated, noncoding transcript .
Author Kameda T and Thomson JA.
Journal Stem Cells 23 (10), 1535-1540 (2005)
Title Role of ERas in promoting tumour-like properties in mouse embryonic stem cells .
Author Takahashi K, Mitsui K and Yamanaka S.
Journal Nature 423 (6939), 541-545 (2003)
Title The human c-Ha-ras2 is a processed pseudogene inactivated by numerous base substitutions .
Author Miyoshi,J., Kagimoto,M., Soeda,E. and Sakaki,Y.
Journal Nucleic Acids Res. 12 (4), 1821-1828 (1984)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.