• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ES cell expressed Ras (ERAS), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_181532 Homo sapiens ES cell expressed Ras (ERAS), mRNA. GenEZ ORF Cloning In-stock $308.00 $259.00 10

*Business Day

Related Services

RefSeq Version NM_181532.3, 427918076
Length 826 bp
Structure linear
Update Date 20-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens ES cell expressed Ras (ERAS), mRNA.
Product GTPase ERas precursor
Comment

Summary: This gene encodes a constitutively active member of the small GTPase Ras protein family. The encoded protein activates the phosphatidylinositol 3-kinase signal transduction pathway in undifferentiated stem cells, but is not expressed in differentiated cells. This gene may be involved in cancer and chemotherapy resistance. [provided by RefSeq, Dec 2012].

RefSeq NP_853510.1
CDS 81..782
Misc Feature(1)249..683
Misc Feature(2)order(267..269,273..275,300..317,327..329,339..344,
Misc Feature(3)order(276..281,297..299,372..374,531..536,540..542,
Misc Feature(4)order(288..290,294..296,312..317,354..359,363..365,
Misc Feature(5)288..314
Misc Feature(6)291..314
Misc Feature(7)297..299
Misc Feature(8)363..374
Misc Feature(9)order(369..377,381..386,396..398,405..407,450..452,
Misc Feature(10)369..425
Misc Feature(11)531..542
Misc Feature(12)order(567..572,579..581,591..593,615..617)
Misc Feature(13)621..629
Exon (1)1..37
Gene:ERAS
Gene Synonym:HRAS2; HRASP
Exon (2)38..826
Gene:ERAS
Gene Synonym:HRAS2; HRASP
Translation MELPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQ LNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVF ALDDPSSLIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVET SAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKTRHQKATCHCGCSVA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
Gene SymbolERAS
Gene SynonymHRAS2; HRASP
ChromosomeX
Locus MapXp11.23
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_181532 Homo sapiens ES cell expressed Ras (ERAS), mRNA. In-stock $308.00 $259.00 10
Title Functional genomics identifies drivers of medulloblastoma dissemination .
Author Mumert,M., Dubuc,A., Wu,X., Northcott,P.A., Chin,S.S., Pedone,C.A., Taylor,M.D. and Fults,D.W.
Journal Cancer Res. 72 (19), 4944-4953 (2012)
Title ERas enhances resistance to CPT-11 in gastric cancer .
Author Kubota,E., Kataoka,H., Tanaka,M., Okamoto,Y., Ebi,M., Hirata,Y., Murakami,K., Mizoshita,T., Shimura,T., Mori,Y., Tanida,S., Kamiya,T., Aoyama,M., Asai,K. and Joh,T.
Journal Anticancer Res. 31 (10), 3353-3360 (2011)
Title Identification of HLA-A*2402-restricted epitope peptide derived from ERas oncogene expressed in human scirrhous gastric cancer .
Author Iwauchi,T., Tanaka,H., Yamazoe,S., Yashiro,M., Yoshii,M., Kubo,N., Muguruma,K., Sawada,T., Ohira,M. and Hirakawa,K.
Journal Cancer Sci. 102 (4), 683-689 (2011)
Title Resistance to chemotherapeutic agents and promotion of transforming activity mediated by embryonic stem cell-expressed Ras (ERas) signal in neuroblastoma cells .
Author Aoyama,M., Kataoka,H., Kubota,E., Tada,T. and Asai,K.
Journal Int. J. Oncol. 37 (4), 1011-1016 (2010)
Title Detection of beta-catenin, gastrokine-2 and embryonic stem cell expressed ras in gastric cancers .
Author Zhang,F., Tang,J.M., Wang,L., Shen,J.Y., Zheng,L., Wu,P.P., Zhang,M. and Yan,Z.W.
Journal Int J Clin Exp Pathol 3 (8), 782-791 (2010)
Title A novel rasH2 mouse carcinogenesis model that is highly susceptible to 4-NQO-induced tongue and esophageal carcinogenesis is useful for preclinical chemoprevention studies .
Author Miyamoto,S., Yasui,Y., Kim,M., Sugie,S., Murakami,A., Ishigamori-Suzuki,R. and Tanaka,T.
Journal Carcinogenesis 29 (2), 418-426 (2008)
Title ERas oncogene expression and epigenetic regulation by histone acetylation in human cancer cells .
Author Yasuda,K., Yashiro,M., Sawada,T., Ohira,M. and Hirakawa,K.
Journal Anticancer Res. 27 (6B), 4071-4075 (2007)
Title Human ERas gene has an upstream premature polyadenylation signal that results in a truncated, noncoding transcript .
Author Kameda,T. and Thomson,J.A.
Journal Stem Cells 23 (10), 1535-1540 (2005)
Title Role of ERas in promoting tumour-like properties in mouse embryonic stem cells .
Author Takahashi,K., Mitsui,K. and Yamanaka,S.
Journal Nature 423 (6939), 541-545 (2003)
Title The human c-Ha-ras2 is a processed pseudogene inactivated by numerous base substitutions .
Author Miyoshi,J., Kagimoto,M., Soeda,E. and Sakaki,Y.
Journal Nucleic Acids Res. 12 (4), 1821-1828 (1984)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.