• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens zinc finger protein 714 (ZNF714), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_182515 Homo sapiens zinc finger protein 714 (ZNF714), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_182515.3, 302318943
Length 8808 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens zinc finger protein 714 (ZNF714), mRNA.
Product zinc finger protein 714
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DB028091.1, BC050468.2, AC010620.4 and BC022527.1. On Aug 6, 2010 this sequence version replaced gi:144953912.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.


##Evidence-Data-START## Transcript exon combination :: DA026469.1, AK056006.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025084, ERS025088 [ECO:0000348] ##Evidence-Data-END##

RefSeq NP_872321.2
CDS 379..2046
Misc Feature(1)<382..486
Misc Feature(2)<382..486
Misc Feature(3)715..1878
Misc Feature(4)769..840
Misc Feature(5)940..1014
Misc Feature(6)1024..1092
Misc Feature(7)1105..1182
Misc Feature(8)1360..1431
Misc Feature(9)1441..1518
Misc Feature(10)1528..1602
Misc Feature(11)1609..1686
Misc Feature(12)1693..1770
Misc Feature(13)1777..1854
Exon (1)1..202
Gene:ZNF714
Gene Synonym:ZNF714
Exon (2)203..294
Gene:ZNF714
Gene Synonym:ZNF714
Exon (3)295..421
Gene:ZNF714
Gene Synonym:ZNF714
Exon (4)422..520
Gene:ZNF714
Gene Synonym:ZNF714
Exon (5)521..8808
Gene:ZNF714
Gene Synonym:ZNF714
Translation MNVMLENYKNLVFLAGIAVSKQDPITSLEQEKEPWNMKICEMVDESPAMCSSFTRDLWPE QDIKDSFQQVILRRHGKCEHENLQLRKGSANVVECKVYKKGYNELNQCLTTTQSKIFPCD KYIKVFHKIFNSNRHKTRHTGEKPFKCKKCDESFCMLLHLHQHKRIHIRENSYQCEECDK VFKRFSTLTRHKRVHTGEKPFKCEECGKAFKHSSTLTTHKMIHTGEKPYRCEECGKAFYH SSHLTTHKVIHTGEKPFKCEECGKAFNHPSALTTHKFIHVKEKPYKCEECDKAFNRFSYL TKHKIIHSGEKSYKCEQCGKGFNWSSTLTKHKRIHTGEKPYKCEECGKAFNVSSHLTTHK MIHTGEKPYKCEECGKAFNHSSKLTIHKIIHTGEKPYKCEECGKAFNQSSNLTKHKIIHT GEKLYKCEECGKAFNRSSNLTTHKRIHTGEKPYKCEECGKAFNRSSNLTKHNIIHTGEKS YKCEECGKAFNQSSTLTKHRKIQQGMVAHACNPNTLRGLGEQIARSGVQDQPGQHGKTPS LLKIQKFAGCGGRRL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
16+dbSNP:
16+g, tdbSNP:201585327
57+c, gdbSNP:113495616
158+a, gdbSNP:61733856
176+a, gdbSNP:112345825
201+c, tdbSNP:200891725
205+dbSNP:
205+c, tdbSNP:190091971
206+a, gdbSNP:193172197
326+dbSNP:
326+a, cdbSNP:147821041
523+dbSNP:
523+a, gdbSNP:201067883
586+g, tdbSNP:199675041
642+a, cdbSNP:148214959
681..682+, tadbSNP:202144538
682..683+, aat, atadbSNP:146707197
682..683+, atadbSNP:36125838
683..684+, aat, atadbSNP:67249728
683..684+, atadbSNP:139363381
688+a, gdbSNP:111443257
765+g, tdbSNP:115651075
886+g, tdbSNP:187722159
929+a, gdbSNP:61740552
965+c, tdbSNP:202078277
1014+c, gdbSNP:183881218
1035+c, tdbSNP:141224149
1036+a, cdbSNP:147350633
1053+a, cdbSNP:112722125
1054+a, gdbSNP:199888679
1067+a, gdbSNP:145031642
1107+a, cdbSNP:188561214
1133+c, tdbSNP:201178018
1195+a, gdbSNP:140003541
1373+a, gdbSNP:2884554
1411+c, gdbSNP:191924584
1534+a, gdbSNP:201748296
1535+c, tdbSNP:185325871
1539+c, tdbSNP:145827373
1549+c, tdbSNP:190621199
1621+c, tdbSNP:148951008
1732+c, tdbSNP:182226945
1768+c, tdbSNP:200962863
1786+a, gdbSNP:186022340
1795+a, tdbSNP:144337339
1798+a, gdbSNP:10427116
1844+a, cdbSNP:200293321
1864+c, gdbSNP:146545256
1875+c, tdbSNP:111456417
1903+c, tdbSNP:144995791
1919+a, gdbSNP:200407781
1934+g, tdbSNP:111990779
1948+a, gdbSNP:199570046
1982+a, gdbSNP:200683676
2061+a, gdbSNP:113071148
2122+c, tdbSNP:8100289
2137+c, gdbSNP:188139353
2161+c, gdbSNP:200367614
2166+, adbSNP:71176814
2166+, a, aaaaaaadbSNP:113144194
2369+a, gdbSNP:113437592
2427+c, tdbSNP:180942485
2436+c, tdbSNP:185510818
2462+a, gdbSNP:149271220
2654+c, tdbSNP:190274274
2666+, tdbSNP:112499059
2717+c, tdbSNP:147366447
2871+c, gdbSNP:201048780
2881+c, gdbSNP:183675865
3114..3115+, adbSNP:139038996
3115..3116+, adbSNP:144625299
3155+g, tdbSNP:138023120
3314..3316+, gtadbSNP:199642443
3382+, tdbSNP:58005745
3403+, tdbSNP:61551744
3417+a, gdbSNP:186899325
3430+a, tdbSNP:192236118
3595+a, gdbSNP:183717165
3731+c, tdbSNP:73024662
3764+c, tdbSNP:112488004
3795+a, gdbSNP:189144783
3817+a, gdbSNP:7253950
3859+a, gdbSNP:7254302
3898+a, gdbSNP:147145688
3900+c, tdbSNP:148791020
4022+a, gdbSNP:113008720
4255..4256+, atadbSNP:138336546
4256+g, tdbSNP:146331256
4257..4258+, atadbSNP:71176815
4257+a, tdbSNP:145100072
4258..4259+, atadbSNP:66490453
4258+a, tdbSNP:141265094
4262+c, tdbSNP:150261062
4265+a, cdbSNP:142831841
4266+a, cdbSNP:139646439
4288+c, tdbSNP:73024665
4317+a, gdbSNP:73024668
4394+c, tdbSNP:73024670
4418+a, gdbSNP:191101023
4425+c, gdbSNP:73024671
4431+g, tdbSNP:62124883
4481..4482+, tdbSNP:76655047
4482..4483+, tdbSNP:11412088
4484..4485+, adbSNP:200383268
4611+c, gdbSNP:150875287
4654+a, gdbSNP:8111827
4723+c, tdbSNP:182236454
4789+c, tdbSNP:186967589
4791+a, gdbSNP:191865951
4827+a, gdbSNP:144400836
4914+a, tdbSNP:112082522
5061+c, tdbSNP:146564646
5154+g, tdbSNP:140084466
5317+a, gdbSNP:113665008
5385+a, cdbSNP:145728091
5392+a, gdbSNP:185194198
5444+c, tdbSNP:188512257
5481+a, gdbSNP:193167226
5574+c, tdbSNP:149110191
5589+a, gdbSNP:73024674
5600+a, gdbSNP:185433863
5813+a, gdbSNP:143211742
5861+a, gdbSNP:189470705
6028+c, tdbSNP:73024675
6056+a, cdbSNP:201709144
6058+a, tdbSNP:151223039
6129+c, gdbSNP:141291586
6181+c, gdbSNP:146988138
6201+a, gdbSNP:137984849
6247+c, tdbSNP:143553695
6248+a, gdbSNP:10405406
6358+a, cdbSNP:180696421
6393+c, tdbSNP:115527685
6471+a, gdbSNP:9304982
6607+a, gdbSNP:150083388
6608+a, cdbSNP:111768785
6634+c, tdbSNP:183967326
6746+a, tdbSNP:10413492
6865..6866+, adbSNP:34326769
6866..6867+, aaadbSNP:59343762
6866+, aaaaaaaadbSNP:71746015
6960+c, tdbSNP:188599119
7162+a, gdbSNP:10413226
7223+c, tdbSNP:113967228
7244+a, tdbSNP:181423327
7415+c, tdbSNP:148587495
7485..7486+, cdbSNP:36044558
7576+a, gdbSNP:12462878
7685+a, cdbSNP:199881991
7719+a, gdbSNP:113771154
7824+c, tdbSNP:11085431
7953+a, gdbSNP:115013501
8115+c, tdbSNP:73024685
8146+a, gdbSNP:186628226
8159+a, tdbSNP:142920024
8177+c, tdbSNP:73024688
8229+c, gdbSNP:10423541
8257+a, gdbSNP:73926925
8461+a, cdbSNP:191469039
8492+c, tdbSNP:181935439
8624+c, tdbSNP:2115493
8654..8655+, ttdbSNP:139973065
8654+, ttdbSNP:58610412
8656..8657+, gdbSNP:201534832
Gene SymbolZNF714
Gene SynonymZNF714
Chromosome19
Locus Map19p12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_182515 Homo sapiens zinc finger protein 714 (ZNF714), mRNA. On-demand TBD TBD
Title Transcriptome analysis of human gastric cancer .
Author Oh,J.H., Yang,J.O., Hahn,Y., Kim,M.R., Byun,S.S., Jeon,Y.J., Kim,J.M., Song,K.S., Noh,S.M., Kim,S., Yoo,H.S., Kim,Y.S. and Kim,N.S.
Journal Mamm. Genome 16 (12), 942-954 (2005)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.