Homo sapiens zinc finger protein 714 (ZNF714), mRNA.
| RefSeq Version | NM_182515.3, 302318943 |
| Length | 8808 bp |
| Structure | linear |
| Update Date | 21-APR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens zinc finger protein 714 (ZNF714), mRNA. |
| Product | zinc finger protein 714 |
| Comment | COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DB028091.1, BC050468.2, AC010620.4 and BC022527.1. On Aug 6, 2010 this sequence version replaced gi:144953912. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. |
| RefSeq | NP_872321.2 |
| CDS | 379..2046 | Exon (1) | 1..202 | Exon (2) | 1..202 | Exon (3) | 203..294 | Exon (4) | 295..421 | Exon (5) | 422..520 | Exon (6) | 521..8808 |
| Translation | MNVMLENYKNLVFLAGIAVSKQDPITSLEQEKEPWNMKICEMVDESPAMCSSFTRDLWPE
QDIKDSFQQVILRRHGKCEHENLQLRKGSANVVECKVYKKGYNELNQCLTTTQSKIFPCD
KYIKVFHKIFNSNRHKTRHTGEKPFKCKKCDESFCMLLHLHQHKRIHIRENSYQCEECDK
VFKRFSTLTRHKRVHTGEKPFKCEECGKAFKHSSTLTTHKMIHTGEKPYRCEECGKAFYH
SSHLTTHKVIHTGEKPFKCEECGKAFNHPSALTTHKFIHVKEKPYKCEECDKAFNRFSYL
TKHKIIHSGEKSYKCEQCGKGFNWSSTLTKHKRIHTGEKPYKCEECGKAFNVSSHLTTHK
MIHTGEKPYKCEECGKAFNHSSKLTIHKIIHTGEKPYKCEECGKAFNQSSNLTKHKIIHT
GEKLYKCEECGKAFNRSSNLTTHKRIHTGEKPYKCEECGKAFNRSSNLTKHNIIHTGEKS
YKCEECGKAFNQSSTLTKHRKIQQGMVAHACNPNTLRGLGEQIARSGVQDQPGQHGKTPS
LLKIQKFAGCGGRRL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| Gene Symbol | ZNF714 |
| Gene Synonym | DKFZp547O168; FLJ33668; FLJ43674 |
| Chromosome | 19 |
| Locus Map | 19p12 |
| All Transcripts | NM_182515 |
| Title | Transcriptome analysis of human gastric cancer . |
| Author | Oh,J.H., Yang,J.O., Hahn,Y., Kim,M.R., Byun,S.S., Jeon,Y.J., Kim,J.M., Song,K.S., Noh,S.M., Kim,S., Yoo,H.S., Kim,Y.S. and Kim,N.S. |
| Journal | Mamm. Genome 16 (12), 942-954 (2005) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |