• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens zinc finger protein 714 (ZNF714), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu17034 Homo sapiens zinc finger protein 714 (ZNF714), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $TBD TBD
OHu17034C Homo sapiens zinc finger protein 714 (ZNF714), transcript variant 1, mRNA. Customized vector On-demand $269.00 TBD

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_182515.3, 302318943
Length 1668 bp
Structure linear
Update Date 25-APR-2014
Organism Homo sapiens (human)
Definition Homo sapiens zinc finger protein 714 (ZNF714), transcript variant 1, mRNA.
Product zinc finger protein 714
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DB028091.1, BC050468.2, AC010620.4 and BC022527.1. On Aug 6, 2010 this sequence version replaced gi:144953912.


Transcript Variant: This variant (1) represents the longest transcript and encodes the supported protein.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.


##Evidence-Data-START## Transcript exon combination :: DA026469.1, AK056006.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025082, ERS025084 [ECO:0000348] ##Evidence-Data-END##

RefSeq NP_872321.2
CDS 379..2046
Misc Feature(1)<382..486
Misc Feature(2)<382..486
Misc Feature(3)889..1890
Misc Feature(4)940..1014
Misc Feature(5)1024..1092
Misc Feature(6)1105..1182
Misc Feature(7)1360..1431
Misc Feature(8)1441..1518
Misc Feature(9)1528..1602
Misc Feature(10)1609..1686
Misc Feature(11)1693..1770
Misc Feature(12)1777..1854
Exon (1)1..202
Gene:ZNF714
Gene Synonym:ZNF714
Exon (2)203..294
Gene:ZNF714
Gene Synonym:ZNF714
Exon (3)295..421
Gene:ZNF714
Gene Synonym:ZNF714
Exon (4)422..520
Gene:ZNF714
Gene Synonym:ZNF714
Exon (5)521..8808
Gene:ZNF714
Gene Synonym:ZNF714
Translation MNVMLENYKNLVFLAGIAVSKQDPITSLEQEKEPWNMKICEMVDESPAMCSSFTRDLWPE QDIKDSFQQVILRRHGKCEHENLQLRKGSANVVECKVYKKGYNELNQCLTTTQSKIFPCD KYIKVFHKIFNSNRHKTRHTGEKPFKCKKCDESFCMLLHLHQHKRIHIRENSYQCEECDK VFKRFSTLTRHKRVHTGEKPFKCEECGKAFKHSSTLTTHKMIHTGEKPYRCEECGKAFYH SSHLTTHKVIHTGEKPFKCEECGKAFNHPSALTTHKFIHVKEKPYKCEECDKAFNRFSYL TKHKIIHSGEKSYKCEQCGKGFNWSSTLTKHKRIHTGEKPYKCEECGKAFNVSSHLTTHK MIHTGEKPYKCEECGKAFNHSSKLTIHKIIHTGEKPYKCEECGKAFNQSSNLTKHKIIHT GEKLYKCEECGKAFNRSSNLTTHKRIHTGEKPYKCEECGKAFNRSSNLTKHNIIHTGEKS YKCEECGKAFNQSSTLTKHRKIQQGMVAHACNPNTLRGLGEQIARSGVQDQPGQHGKTPS LLKIQKFAGCGGRRL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
16+dbSNP:
16+g, tdbSNP:201585327
57+c, gdbSNP:113495616
79+a, gdbSNP:367638179
158+a, gdbSNP:61733856
176+a, gdbSNP:112345825
201+c, tdbSNP:200891725
205+dbSNP:
205+c, tdbSNP:190091971
206+a, gdbSNP:193172197
312+dbSNP:
312+c, gdbSNP:369719006
326+a, cdbSNP:147821041
392+c, tdbSNP:374922556
417+c, gdbSNP:377697860
449+dbSNP:
449+c, tdbSNP:374215744
450+a, gdbSNP:368674204
486+c, tdbSNP:371673567
523+dbSNP:
523+a, gdbSNP:201067883
532+c, tdbSNP:371085101
586+g, tdbSNP:199675041
590+c, tdbSNP:371213927
610+c, tdbSNP:374811110
complement(642)-c, adbSNP:148214959
645+c, tdbSNP:369783391
646+a, gdbSNP:372934750
659+a, cdbSNP:375524414
664+a, gdbSNP:370765701
681..682+, tadbSNP:202144538
686..687+, aat, atadbSNP:67249728
687..688+, aatdbSNP:57999210
688+a, gdbSNP:111443257
765+g, tdbSNP:115651075
886+g, tdbSNP:187722159
929+a, gdbSNP:61740552
949+c, gdbSNP:373144420
961+c, gdbSNP:377506115
965+c, tdbSNP:202078277
982+a, gdbSNP:375364097
1012+c, tdbSNP:373168377
1014+c, gdbSNP:183881218
1035+c, tdbSNP:141224149
1036+a, cdbSNP:147350633
1041+a, gdbSNP:374049841
1053+a, cdbSNP:112722125
1054+a, gdbSNP:199888679
1067+a, gdbSNP:145031642
1107+a, cdbSNP:188561214
1123+a, gdbSNP:374321823
1133+c, tdbSNP:201178018
1171+a, gdbSNP:370476056
1195+a, gdbSNP:140003541
1250+a, gdbSNP:370536525
1340+g, tdbSNP:373632532
1371+c, tdbSNP:373730153
1373+a, gdbSNP:2884554
1411+c, gdbSNP:191924584
1488+a, cdbSNP:376612809
1501+a, gdbSNP:368728981
1528+c, tdbSNP:372317502
1534..1535+at, gcdbSNP:386807749
1534+a, gdbSNP:201748296
1535+c, tdbSNP:185325871
1539+c, tdbSNP:145827373
1549+c, tdbSNP:190621199
1583+g, tdbSNP:376532979
1603+c, tdbSNP:369005946
1617+c, tdbSNP:372670175
1621+c, tdbSNP:148951008
1626+a, gdbSNP:377444694
1629+a, gdbSNP:371197928
1703+c, tdbSNP:375124963
1718+a, gdbSNP:375833603
1732+c, tdbSNP:182226945
1759+a, gdbSNP:373066934
1768+c, tdbSNP:200962863
1769+g, tdbSNP:370427342
1786+a, gdbSNP:186022340
1795+a, tdbSNP:144337339
1798+a, gdbSNP:10427116
1844+a, cdbSNP:200293321
1864+c, gdbSNP:146545256
1875+c, tdbSNP:111456417
1903+c, tdbSNP:144995791
1919+a, gdbSNP:200407781
1934+g, tdbSNP:111990779
1948+a, gdbSNP:199570046
1950+a, gdbSNP:372420809
1982+a, gdbSNP:200683676
2061+a, gdbSNP:113071148
2067..2092+, gaggcaggagaatcatttgaacctggdbSNP:370643299
2074..2099+, gagaatcatttgaacctgggaggcagdbSNP:372532927
2092..2093+, gaggcadbSNP:377217993
2122+c, tdbSNP:8100289
2137+c, gdbSNP:188139353
2159..2160+, gacdbSNP:372040745
2161+c, gdbSNP:200367614
2166+, adbSNP:71176814
2174..2175+, aaagdbSNP:372236589
2286+, adbSNP:368078786
2369+a, gdbSNP:113437592
2410+a, gdbSNP:373882234
2427+c, tdbSNP:180942485
2436+c, tdbSNP:185510818
2445+c, tdbSNP:369307822
2462+a, gdbSNP:149271220
2470+c, gdbSNP:376915807
2544+, tdbSNP:375668421
2634+a, gdbSNP:372238210
2654+c, tdbSNP:190274274
2666+, tdbSNP:112499059
2717+c, tdbSNP:147366447
2845+g, tdbSNP:368755946
2865+a, tdbSNP:376815370
2871+c, gdbSNP:201048780
2881+c, gdbSNP:183675865
2969+c, tdbSNP:373418274
3114..3115+, adbSNP:139038996
3124..3125+, adbSNP:144625299
complement(3155)-t, gdbSNP:138023120
3314..3316+, gtadbSNP:199642443
3386+, tdbSNP:58005745
3404+, tdbSNP:61551744
3405+, adbSNP:376567913
3417+a, gdbSNP:186899325
3422..3425+, taagdbSNP:369312141
3430+a, tdbSNP:192236118
3553+a, gdbSNP:376945645
3595+a, gdbSNP:183717165
3731+c, tdbSNP:73024662
3764+c, tdbSNP:112488004
3764+c, tdbSNP:386453249
3794+c, tdbSNP:373030469
3795+a, gdbSNP:189144783
3817+a, gdbSNP:7253950
3859+a, gdbSNP:7254302
3898+a, gdbSNP:147145688
3900+c, tdbSNP:148791020
4022+a, gdbSNP:113008720
4255..4256+, atadbSNP:138336546
4256+g, tdbSNP:146331256
4257..4258+, atadbSNP:71176815
4257+a, tdbSNP:145100072
4258..4259+, atadbSNP:66490453
4258+a, tdbSNP:141265094
4262+c, tdbSNP:150261062
4265+a, cdbSNP:142831841
4266+a, cdbSNP:139646439
4288+c, tdbSNP:73024665
4317+a, gdbSNP:73024668
4394+c, tdbSNP:73024670
4418+a, gdbSNP:191101023
4425+c, gdbSNP:73024671
4431+g, tdbSNP:62124883
4481..4482+, tdbSNP:11412088
4484..4485+, adbSNP:200383268
4565+c, tdbSNP:377528390
4611+c, gdbSNP:150875287
4654+a, gdbSNP:8111827
4723+c, tdbSNP:182236454
4789+c, tdbSNP:186967589
4791+a, gdbSNP:191865951
4827+a, gdbSNP:144400836
4835+c, tdbSNP:368383750
4852+c, tdbSNP:368540433
4890+c, tdbSNP:372050632
4891+a, gdbSNP:372851080
4914+a, tdbSNP:112082522
5061+c, tdbSNP:146564646
5085+c, tdbSNP:374891645
5154+g, tdbSNP:140084466
5317+a, gdbSNP:113665008
5385+a, cdbSNP:145728091
5392+a, gdbSNP:185194198
5444+c, tdbSNP:188512257
5481+a, gdbSNP:193167226
5494+a, gdbSNP:368238872
complement(5574)-t, cdbSNP:149110191
5589+a, gdbSNP:73024674
5600+a, gdbSNP:185433863
5813+a, gdbSNP:143211742
5861+a, gdbSNP:189470705
6028+c, tdbSNP:73024675
6056+a, cdbSNP:201709144
complement(6058)-t, adbSNP:151223039
6129+c, gdbSNP:141291586
6181+c, gdbSNP:146988138
6201+a, gdbSNP:137984849
6247..6248+ca, tgdbSNP:386807750
6247+c, tdbSNP:143553695
6248+a, gdbSNP:10405406
6358+a, cdbSNP:180696421
6393+c, tdbSNP:115527685
6471+a, gdbSNP:9304982
6547+a, gdbSNP:369618616
6607+a, gdbSNP:150083388
6608+a, cdbSNP:111768785
6634+c, tdbSNP:183967326
6657+c, tdbSNP:372790838
6746+a, tdbSNP:10413492
6865..6866+, adbSNP:34326769
6865+a, cdbSNP:375583286
6882..6883+, aaadbSNP:386388719
6884..6885+, aaadbSNP:59343762
6960+c, tdbSNP:188599119
7097..7098+, adbSNP:375891634
7162+a, gdbSNP:10413226
7223+c, tdbSNP:113967228
7244+a, tdbSNP:181423327
7355+c, gdbSNP:373076409
7415+c, tdbSNP:148587495
7485..7486+, cdbSNP:36044558
7517+a, gdbSNP:376865342
7576+a, gdbSNP:12462878
7685+a, cdbSNP:199881991
7719+a, gdbSNP:113771154
7824+c, tdbSNP:11085431
7897+c, gdbSNP:376354245
7949+c, tdbSNP:373986590
7953+a, gdbSNP:115013501
8115+c, tdbSNP:73024685
8146+a, gdbSNP:186628226
8159+a, tdbSNP:142920024
8177+c, tdbSNP:73024688
8229+c, gdbSNP:10423541
8257+a, gdbSNP:73926925
8461+a, cdbSNP:191469039
8492+c, tdbSNP:181935439
8624+c, tdbSNP:2115493
8653+, cdbSNP:376471757
8654..8655+, ttdbSNP:139973065
8654+, tdbSNP:370954124
8656..8657+, gdbSNP:201534832
8670..8671+, ttdbSNP:58610412
8785+a, gdbSNP:375836578
Gene SymbolZNF714
Gene SynonymZNF714
Chromosome19
Locus Map19p12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_182515 Homo sapiens zinc finger protein 714 (ZNF714), transcript variant 1, mRNA. On-demand TBD TBD
Title Transcriptome analysis of human gastric cancer .
Author Oh JH, Yang JO, Hahn Y, Kim MR, Byun SS, Jeon YJ, Kim JM, Song KS, Noh SM, Kim S, Yoo HS, Kim YS and Kim NS.
Journal Mamm. Genome 16 (12), 942-954 (2005)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.