• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens zinc finger, MYM-type 2 (ZMYM2), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_197968 Homo sapiens zinc finger, MYM-type 2 (ZMYM2), transcript variant 2, mRNA. GenEZ ORF Cloning On-demand $1699.00 25

*Business Day

Related Services

RefSeq Version NM_197968.2, 300192957
Length 10199 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens zinc finger, MYM-type 2 (ZMYM2), transcript variant 2, mRNA.
Product zinc finger MYM-type protein 2
Comment

Summary: The protein encoded by this gene is a zinc finger protein that may act as a transcription factor. The encoded protein may be part of a BHC histone deacetylase complex. Translocation of this gene with the fibroblast growth factor receptor-1 gene (FGFR1) results in a fusion gene, which may be a cause of stem cell leukemia lymphoma syndrome (SCLL). Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2010].


Transcript Variant: This variant (2) differs in the 5' UTR compared to variant 1. All four variants encode the same protein.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_932072.1
CDS 252..4385
Misc Feature(1)75..77
Misc Feature(2)75..77
Misc Feature(3)1158..1160
Misc Feature(4)1158..1160
Misc Feature(5)1164..1166
Misc Feature(6)1218..1340
Misc Feature(7)1335..1337
Misc Feature(8)1344..1478
Misc Feature(9)1509..1619
Misc Feature(10)1626..1757
Misc Feature(11)1833..1961
Misc Feature(12)2142..2264
Misc Feature(13)2268..2387
Misc Feature(14)2406..2525
Misc Feature(15)2532..2648
Misc Feature(16)2763..2765
Misc Feature(17)2763..2765
Misc Feature(18)2988..2993
Misc Feature(19)3123..3125
Misc Feature(20)3819..4334
Misc Feature(21)4377..4379
Exon (1)1..172
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (2)173..241
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (3)242..1098
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (4)1099..1384
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (5)1385..1550
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (6)1551..1763
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (7)1764..1835
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (8)1836..1986
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (9)1987..2102
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (10)2103..2219
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (11)2220..2370
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (12)2371..2543
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (13)2544..2709
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (14)2710..2744
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (15)2745..2874
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (16)2875..2990
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (17)2991..3162
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (18)3163..3288
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (19)3289..3383
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (20)3384..3552
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (21)3553..3704
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (22)3705..3819
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (23)3820..4071
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (24)4072..4192
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (25)4193..10199
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Translation MDTSSVGGLELTDQTPVLLGSTAMATSLTNVGNSFSGPANPLVSRSNKFQNSSVEDDDDV VFIEPVQPPPPSVPVVADQRTITFTSSKNEELQGNDSKITPSSKELASQKGSVSETIVID DEEDMETNQGQEKNSSNFIERRPPETKNRTNDVDFSTSSFSRSKVNAGMGNSGITTEPDS EIQIANVTTLETGVSSVNDGQLENTDGRDMNLMITHVTSLQNTNLGDVSNGLQSSNFGVN IQTYTPSLTSQTKTGVGPFNPGRMNVAGDVFQNGESATHHNPDSWISQSASFPRNQKQPG VDSLSPVASLPKQIFQPSVQQQPTKPVKVTCANCKKPLQKGQTAYQRKGSAHLFCSTTCL SSFSHKPAPKKLCVMCKKDITTMKGTIVAQVDSSESFQEFCSTSCLSLYEDKQNPTKGAL NKSRCTICGKLTEIRHEVSFKNMTHKLCSDHCFNRYRMANGLIMNCCEQCGEYLPSKGAG NNVLVIDGQQKRFCCQSCVSEYKQVGSHPSFLKEVRDHMQDSFLMQPEKYGKLTTCTGCR TQCRFFDMTQCIGPNGYMEPYCSTACMNSHKTKYAKSQSLGIICHFCKRNSLPQYQATMP DGKLYNFCNSSCVAKFQALSMQSSPNGQFVAPSDIQLKCNYCKNSFCSKPEILEWENKVH QFCSKTCSDDYKKLHCIVTYCEYCQEEKTLHETVNFSGVKRPFCSEGCKLLYKQDFARRL GLRCVTCNYCSQLCKKGATKELDGVVRDFCSEDCCKKFQDWYYKAARCDCCKSQGTLKER VQWRGEMKHFCDQHCLLRFYCQQNEPNMTTQKGPENLHYDQGCQTSRTKMTGSAPPPSPT PNKEMKNKAVLCKPLTMTKATYCKPHMQTKSCQTDDTWRTEYVPVPIPVPVYIPVPMHMY SQNIPVPTTVPVPVPVPVFLPAPLDSSEKIPAAIEELKSKVSSDALDTELLTMTDMMSED EGKTETTNINSVIIETDIIGSDLLKNSDPETQSSMPDVPYEPDLDIEIDFPRAAEELDME NEFLLPPVFGEEYEEQPRPRSKKKGAKRKAVSGYQSHDDSSDNSECSFPFKYTYGVNAWK HWVKTRQLDEDLLVLDELKSSKSVKLKEDLLSHTTAELNYGLAHFVNEIRRPNGENYAPD SIYYLCLGIQEYLCGSNRKDNIFIDPGYQTFEQELNKILRSWQPSILPDGSIFSRVEEDY LWRIKQLGSHSPVALLNTLFYFNTKYFGLKTVEQHLRLSFGTVFRHWKKNPLTMENKACL RYQVSSLCGTDNEDKITTGKRKHEDDEPVFEQIENTANPSRCPVKMFECYLSKSPQNLNQ RMDVFYLQPECSSSTDSPVWYTSTSLDRNTLENMLVRVLLVKDIYDKDNYELDEDTD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
159+c, gdbSNP:9508981
218+dbSNP:
218+a, gdbSNP:186012802
268+c, tdbSNP:150173817
366+a, gdbSNP:73428008
406+c, tdbSNP:201629773
410+a, gdbSNP:138911078
483+a, gdbSNP:184955917
527+a, gdbSNP:141166677
579+a, gdbSNP:17853600
705+c, gdbSNP:35516773
759+c, gdbSNP:200050871
946+a, tdbSNP:61762995
1062+g, tdbSNP:41292189
1169+dbSNP:
1169+a, gdbSNP:17853601
1170+g, tdbSNP:61749503
1424+dbSNP:
1424+a, gdbSNP:115819790
1484+c, tdbSNP:116271560
1711+dbSNP:
1711+a, gdbSNP:183882192
1808+dbSNP:
1808+a, gdbSNP:201534436
1823+a, gdbSNP:1132804
1844+dbSNP:
1844+a, gdbSNP:34660436
2144+dbSNP:
2144+a, gdbSNP:183448364
2155+c, tdbSNP:187724961
2291+dbSNP:
2291+c, tdbSNP:79833154
2572+dbSNP:
2572+a, gdbSNP:191062038
2573+a, gdbSNP:183728738
2744+dbSNP:
2744+a, gdbSNP:200592124
2818+dbSNP:
2818+c, tdbSNP:17857106
3062+dbSNP:
3062+a, gdbSNP:200823271
3107+a, gdbSNP:199677304
3108+a, gdbSNP:115802719
3181+dbSNP:
3181+a, cdbSNP:200140595
3197+a, cdbSNP:145243906
3216+c, tdbSNP:192135180
3248+a, gdbSNP:185714432
3307+dbSNP:
3307+c, tdbSNP:201556992
3341+c, tdbSNP:199880478
3469+dbSNP:
3469+c, tdbSNP:201336940
3470+a, gdbSNP:202171881
3596+dbSNP:
3596+a, gdbSNP:17075877
4019+dbSNP:
4019+c, tdbSNP:139017565
4026+c, tdbSNP:17853599
4130+dbSNP:
4130+g, tdbSNP:202121801
4137+a, cdbSNP:75797463
4317+a, gdbSNP:201569165
4361+c, tdbSNP:200564632
4390+a, gdbSNP:199556658
4393+c, tdbSNP:201201280
4456+a, gdbSNP:185449063
4606+c, tdbSNP:189085406
4630..4633+, tgttdbSNP:201534219
4703+c, tdbSNP:9889
4921+c, gdbSNP:201040788
4969..4970+, tatadbSNP:10696399
5026..5027+, tdbSNP:34490345
5142..5143+, tadbSNP:35941536
5142+a, gdbSNP:201182582
5143..5144+, tadbSNP:71812643
5143+, tadbSNP:60929377
5170..5171+, tadbSNP:71070295
5347+a, gdbSNP:259778
5349+a, gdbSNP:17076304
5361+a, gdbSNP:181479847
5526+c, tdbSNP:148818395
5548+c, gdbSNP:142582476
5738..5739+, tdbSNP:34042420
6059+c, tdbSNP:187578947
6060+c, tdbSNP:150956340
6142+a, cdbSNP:140854224
6161+c, tdbSNP:1047934
6296+g, tdbSNP:202200789
6334+g, tdbSNP:1047936
6520+c, tdbSNP:145113739
6670+c, tdbSNP:117570747
6726+c, tdbSNP:138932325
6788+a, tdbSNP:78022149
6834+c, tdbSNP:116637088
6875+a, gdbSNP:191867357
7096+g, tdbSNP:182906408
7099+c, tdbSNP:185791087
7217+c, tdbSNP:140727584
7297+c, tdbSNP:190255600
7320+a, gdbSNP:59918656
7659+a, gdbSNP:182819882
7669+c, tdbSNP:187105923
7762+c, gdbSNP:150476408
7788+c, tdbSNP:138167590
7837+a, gdbSNP:116376020
7880+a, gdbSNP:115610469
8037..8038+, adbSNP:35987572
8099+c, tdbSNP:192278120
8116+c, tdbSNP:113193926
8117+a, gdbSNP:111750975
8267+a, cdbSNP:12875896
8272+c, tdbSNP:200743730
8273..8274+, adbSNP:11404954
8274..8275+, adbSNP:11447070
8321+a, cdbSNP:183321078
8443+c, tdbSNP:143315124
8491+a, gdbSNP:148326472
8540..8541+, cdbSNP:35211768
8540+a, gdbSNP:9509031
8572+c, tdbSNP:114085584
8719+a, tdbSNP:9509032
8756+g, tdbSNP:202150228
8783..8784+, tdbSNP:35367910
8784..8785+, tdbSNP:67061595
8790..8791+, tdbSNP:201680523
8850+c, gdbSNP:74035911
8888+a, gdbSNP:189125912
8976+g, tdbSNP:71424022
9050+g, tdbSNP:9509033
9087+c, gdbSNP:193023777
9137+a, gdbSNP:184500081
9248+c, tdbSNP:189369654
9307+c, tdbSNP:191233361
9321+a, tdbSNP:184104508
9349+a, gdbSNP:188452566
9377+c, gdbSNP:143069637
9380+c, tdbSNP:147196822
9517+a, gdbSNP:140476185
9539+a, tdbSNP:181601105
9547+a, cdbSNP:113407121
9642+a, gdbSNP:142923297
9874+a, gdbSNP:150794326
9892+a, gdbSNP:139064118
9904+c, tdbSNP:149878910
9910+c, gdbSNP:76853155
9957+a, gdbSNP:186596118
10009..10010+, cagtdbSNP:151013533
10045+c, gdbSNP:116149792
Gene SymbolZMYM2
Gene SynonymFIM; MYM; RAMP; SCLL; ZNF198
Chromosome13
Locus Map13q11-q12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001190964 Homo sapiens zinc finger, MYM-type 2 (ZMYM2), transcript variant 3, mRNA. On-demand $1699.00 25
NM_001190965 Homo sapiens zinc finger, MYM-type 2 (ZMYM2), transcript variant 4, mRNA. On-demand $1699.00 25
NM_003453 Homo sapiens zinc finger, MYM-type 2 (ZMYM2), transcript variant 1, mRNA. On-demand $1699.00 25
NM_197968 Homo sapiens zinc finger, MYM-type 2 (ZMYM2), transcript variant 2, mRNA. On-demand $1699.00 25
Title Proteins ZNF198 and SUZ12 are down-regulated in hepatitis B virus (HBV) X protein-mediated hepatocyte transformation and in HBV replication .
Author Wang,W.H., Studach,L.L. and Andrisani,O.M.
Journal Hepatology 53 (4), 1137-1147 (2011)
Title Genetic fingerprinting of the development and progression of T-cell lymphoma in a murine model of atypical myeloproliferative disorder initiated by the ZNF198-fibroblast growth factor receptor-1 chimeric tyrosine kinase .
Author Ren,M., Li,X. and Cowell,J.K.
Journal Blood 114 (8), 1576-1584 (2009)
Title Phosphorylation of the SSBP2 and ABL proteins by the ZNF198-FGFR1 fusion kinase seen in atypical myeloproliferative disorders as revealed by phosphopeptide-specific MS .
Author Kasyapa,C., Gu,T.L., Nagarajan,L., Polakiewicz,R. and Cowell,J.K.
Journal Proteomics 9 (16), 3979-3988 (2009)
Title ZNF198 stabilizes the LSD1-CoREST-HDAC1 complex on chromatin through its MYM-type zinc fingers .
Author Gocke,C.B. and Yu,H.
Journal PLoS ONE 3 (9), E3255 (2008)
Title HSPA1A is an important regulator of the stability and function of ZNF198 and its oncogenic derivative, ZNF198-FGFR1 .
Author Kasyapa,C.S., Kunapuli,P. and Cowell,J.K.
Journal J. Cell. Biochem. 102 (5), 1308-1317 (2007)
Title Consistent fusion of ZNF198 to the fibroblast growth factor receptor-1 in the t(8;13)(p11;q12) myeloproliferative syndrome .
Author Reiter,A., Sohal,J., Kulkarni,S., Chase,A., Macdonald,D.H., Aguiar,R.C., Goncalves,C., Hernandez,J.M., Jennings,B.A., Goldman,J.M. and Cross,N.C.
Journal Blood 92 (5), 1735-1742 (1998)
Title The t(8;13) atypical myeloproliferative disorder: further analysis of the ZNF198 gene and lack of evidence for multiple genes disrupted on chromosome 13 .
Author Still,I.H. and Cowell,J.K.
Journal Blood 92 (4), 1456-1458 (1998)
Title Fibroblast growth factor receptor 1 is fused to FIM in stem-cell myeloproliferative disorder with t(8;13) .
Author Popovici,C., Adelaide,J., Ollendorff,V., Chaffanet,M., Guasch,G., Jacrot,M., Leroux,D., Birnbaum,D. and Pebusque,M.J.
Journal Proc. Natl. Acad. Sci. U.S.A. 95 (10), 5712-5717 (1998)
Title The t(8;13)(p11;q11-12) rearrangement associated with an atypical myeloproliferative disorder fuses the fibroblast growth factor receptor 1 gene to a novel gene RAMP .
Author Smedley,D., Hamoudi,R., Clark,J., Warren,W., Abdul-Rauf,M., Somers,G., Venter,D., Fagan,K., Cooper,C. and Shipley,J.
Journal Hum. Mol. Genet. 7 (4), 637-642 (1998)
Title FGFR1 is fused with a novel zinc-finger gene, ZNF198, in the t(8;13) leukaemia/lymphoma syndrome .
Author Xiao,S., Nalabolu,S.R., Aster,J.C., Ma,J., Abruzzo,L., Jaffe,E.S., Stone,R., Weissman,S.M., Hudson,T.J. and Fletcher,J.A.
Journal Nat. Genet. 18 (1), 84-87 (1998)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.