• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens zinc finger, MYM-type 2 (ZMYM2), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_197968 Homo sapiens zinc finger, MYM-type 2 (ZMYM2), transcript variant 2, mRNA. GenEZ ORF Cloning On-demand $1699.00 25

*Business Day

Related Services

RefSeq Version NM_197968.3, 597955375
Length 10216 bp
Structure linear
Update Date 11-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens zinc finger, MYM-type 2 (ZMYM2), transcript variant 2, mRNA.
Product zinc finger MYM-type protein 2
Comment

Summary: The protein encoded by this gene is a zinc finger protein that may act as a transcription factor. The encoded protein may be part of a BHC histone deacetylase complex. Translocation of this gene with the fibroblast growth factor receptor-1 gene (FGFR1) results in a fusion gene, which may be a cause of stem cell leukemia lymphoma syndrome (SCLL). Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2010].


Transcript Variant: This variant (2) differs in the 5' UTR compared to variant 1. Variants 1-4 encode the same protein.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_932072.1
CDS 252..4385
Misc Feature(1)75..77
Misc Feature(2)1158..1160
Misc Feature(3)1158..1160
Misc Feature(4)1164..1166
Misc Feature(5)1218..1340
Misc Feature(6)1335..1337
Misc Feature(7)1344..1478
Misc Feature(8)1509..1619
Misc Feature(9)1626..1757
Misc Feature(10)1833..1961
Misc Feature(11)2142..2264
Misc Feature(12)2406..2525
Misc Feature(13)2532..2648
Misc Feature(14)2763..2765
Misc Feature(15)2763..2765
Misc Feature(16)2988..2993
Misc Feature(17)3123..3125
Misc Feature(18)3819..4334
Misc Feature(19)4377..4379
Exon (1)1..172
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (2)173..241
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (3)242..1098
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (4)1099..1384
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (5)1385..1550
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (6)1551..1763
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (7)1764..1835
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (8)1836..1986
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (9)1987..2102
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (10)2103..2219
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (11)2220..2370
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (12)2371..2543
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (13)2544..2709
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (14)2710..2744
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (15)2745..2874
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (16)2875..2990
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (17)2991..3162
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (18)3163..3288
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (19)3289..3383
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (20)3384..3552
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (21)3553..3704
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (22)3705..3819
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (23)3820..4071
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (24)4072..4192
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Exon (25)4193..10216
Gene:ZMYM2
Gene Synonym:FIM; MYM; RAMP; SCLL; ZNF198
Translation MDTSSVGGLELTDQTPVLLGSTAMATSLTNVGNSFSGPANPLVSRSNKFQNSSVEDDDDV VFIEPVQPPPPSVPVVADQRTITFTSSKNEELQGNDSKITPSSKELASQKGSVSETIVID DEEDMETNQGQEKNSSNFIERRPPETKNRTNDVDFSTSSFSRSKVNAGMGNSGITTEPDS EIQIANVTTLETGVSSVNDGQLENTDGRDMNLMITHVTSLQNTNLGDVSNGLQSSNFGVN IQTYTPSLTSQTKTGVGPFNPGRMNVAGDVFQNGESATHHNPDSWISQSASFPRNQKQPG VDSLSPVASLPKQIFQPSVQQQPTKPVKVTCANCKKPLQKGQTAYQRKGSAHLFCSTTCL SSFSHKPAPKKLCVMCKKDITTMKGTIVAQVDSSESFQEFCSTSCLSLYEDKQNPTKGAL NKSRCTICGKLTEIRHEVSFKNMTHKLCSDHCFNRYRMANGLIMNCCEQCGEYLPSKGAG NNVLVIDGQQKRFCCQSCVSEYKQVGSHPSFLKEVRDHMQDSFLMQPEKYGKLTTCTGCR TQCRFFDMTQCIGPNGYMEPYCSTACMNSHKTKYAKSQSLGIICHFCKRNSLPQYQATMP DGKLYNFCNSSCVAKFQALSMQSSPNGQFVAPSDIQLKCNYCKNSFCSKPEILEWENKVH QFCSKTCSDDYKKLHCIVTYCEYCQEEKTLHETVNFSGVKRPFCSEGCKLLYKQDFARRL GLRCVTCNYCSQLCKKGATKELDGVVRDFCSEDCCKKFQDWYYKAARCDCCKSQGTLKER VQWRGEMKHFCDQHCLLRFYCQQNEPNMTTQKGPENLHYDQGCQTSRTKMTGSAPPPSPT PNKEMKNKAVLCKPLTMTKATYCKPHMQTKSCQTDDTWRTEYVPVPIPVPVYIPVPMHMY SQNIPVPTTVPVPVPVPVFLPAPLDSSEKIPAAIEELKSKVSSDALDTELLTMTDMMSED EGKTETTNINSVIIETDIIGSDLLKNSDPETQSSMPDVPYEPDLDIEIDFPRAAEELDME NEFLLPPVFGEEYEEQPRPRSKKKGAKRKAVSGYQSHDDSSDNSECSFPFKYTYGVNAWK HWVKTRQLDEDLLVLDELKSSKSVKLKEDLLSHTTAELNYGLAHFVNEIRRPNGENYAPD SIYYLCLGIQEYLCGSNRKDNIFIDPGYQTFEQELNKILRSWQPSILPDGSIFSRVEEDY LWRIKQLGSHSPVALLNTLFYFNTKYFGLKTVEQHLRLSFGTVFRHWKKNPLTMENKACL RYQVSSLCGTDNEDKITTGKRKHEDDEPVFEQIENTANPSRCPVKMFECYLSKSPQNLNQ RMDVFYLQPECSSSTDSPVWYTSTSLDRNTLENMLVRVLLVKDIYDKDNYELDEDTD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
47+dbSNP:
47+g, tdbSNP:371596999
113+c, tdbSNP:375361405
159+c, gdbSNP:9508981
218+dbSNP:
218+a, gdbSNP:186012802
268+c, tdbSNP:150173817
316+c, tdbSNP:367780861
338+a, gdbSNP:371685601
363+c, tdbSNP:376262091
366+a, gdbSNP:73428008
398+c, tdbSNP:373698674
406+c, tdbSNP:201629773
410+a, gdbSNP:138911078
426+c, gdbSNP:375763195
432+g, tdbSNP:369874142
479+a, gdbSNP:374584619
483+a, gdbSNP:184955917
527+a, gdbSNP:141166677
549+a, gdbSNP:370438202
579+a, gdbSNP:17853600
620+a, gdbSNP:372753077
625+a, tdbSNP:377182036
705+c, gdbSNP:35516773
759+c, gdbSNP:200050871
854+a, gdbSNP:375228563
942+a, gdbSNP:376753667
946+a, tdbSNP:61762995
1005+a, gdbSNP:371862089
1058+c, tdbSNP:374884303
1062+g, tdbSNP:41292189
1146+dbSNP:
1146+a, cdbSNP:372928628
1169+a, gdbSNP:17853601
1170+g, tdbSNP:61749503
1198+a, tdbSNP:369904406
1301+a, tdbSNP:373306390
1310+c, tdbSNP:377500017
1375+c, tdbSNP:370107310
1424+dbSNP:
1424+a, gdbSNP:115819790
1484+c, tdbSNP:116271560
1490+a, gdbSNP:369748973
1511+a, gdbSNP:374428386
1523+a, gdbSNP:377254375
1667+dbSNP:
1667+a, gdbSNP:373133861
1698+a, gdbSNP:376390813
1711+a, gdbSNP:183882192
1808+dbSNP:
1808+a, gdbSNP:201534436
1818+c, tdbSNP:372944276
1823+a, gdbSNP:1132804
1844+dbSNP:
1844+a, gdbSNP:34660436
1950+a, gdbSNP:376437929
1966+c, tdbSNP:370103279
1977+a, gdbSNP:374284314
2144+dbSNP:
2144+a, gdbSNP:183448364
2149+a, gdbSNP:372402171
2155+c, tdbSNP:187724961
2207+c, tdbSNP:370131189
2288+dbSNP:
2288+a, gdbSNP:375789681
2291+c, tdbSNP:79833154
2373+dbSNP:
2373+c, tdbSNP:369379233
2454+a, gdbSNP:373188748
2477+c, tdbSNP:376299638
2518+a, gdbSNP:371444074
2540+c, tdbSNP:374763735
2572+dbSNP:
2572+a, gdbSNP:191062038
2573+a, gdbSNP:183728738
2618+c, tdbSNP:375061678
2630+a, gdbSNP:368062348
2731+dbSNP:
2731+a, gdbSNP:375597494
2744+a, gdbSNP:200592124
2798+dbSNP:
2798+a, cdbSNP:371325839
2818+c, tdbSNP:17857106
2933+dbSNP:
2933+a, gdbSNP:369728785
3028+dbSNP:
3028+a, gdbSNP:373322692
3062+a, gdbSNP:200823271
3107+a, gdbSNP:199677304
3108+a, gdbSNP:115802719
3113+a, gdbSNP:368425010
3181+dbSNP:
3181+a, cdbSNP:200140595
3183+a, gdbSNP:368727505
3197+a, cdbSNP:145243906
3216+c, tdbSNP:192135180
3224+a, gdbSNP:374700875
3248+a, gdbSNP:185714432
3305+dbSNP:
3305+c, tdbSNP:375300486
3307+c, tdbSNP:201556992
3341+c, tdbSNP:199880478
3362+c, gdbSNP:370561438
3417+dbSNP:
3417+c, tdbSNP:374570432
3433+c, gdbSNP:377391104
3439+a, tdbSNP:370436208
3469+c, tdbSNP:201336940
3470+a, gdbSNP:202171881
3516+c, gdbSNP:371034388
3567+dbSNP:
3567+g, tdbSNP:368414953
3576+g, tdbSNP:371024048
3596+a, gdbSNP:17075877
3614+a, gdbSNP:370894728
3629+c, tdbSNP:367583188
3658+a, cdbSNP:371332712
3675+a, gdbSNP:374623710
3679+a, gdbSNP:368114931
3878+dbSNP:
3878+a, gdbSNP:375482120
3953+a, gdbSNP:369735750
4019+c, tdbSNP:139017565
4025+a, gdbSNP:377253324
4026+c, tdbSNP:17853599
4037+c, tdbSNP:368664256
4130+dbSNP:
4130+g, tdbSNP:202121801
complement(4137)-c, adbSNP:75797463
4202+dbSNP:
4202+c, tdbSNP:374447547
4236+a, cdbSNP:376480008
4244+c, tdbSNP:370286795
4266+g, tdbSNP:373652432
4283+c, tdbSNP:367792422
4317+a, gdbSNP:201569165
4361+c, tdbSNP:200564632
4390+a, gdbSNP:199556658
4393+c, tdbSNP:201201280
4456+a, gdbSNP:185449063
4555+c, tdbSNP:373462446
4606+c, tdbSNP:189085406
4630..4633+, tgttdbSNP:201534219
4652+a, gdbSNP:368580420
4703+c, tdbSNP:9889
4826+c, tdbSNP:371655871
4921+c, gdbSNP:201040788
5026..5027+, tdbSNP:34490345
5132..5133+, tgdbSNP:368935953
5142..5143+, tadbSNP:35941536
5142+a, gdbSNP:201182582
5143..5144+, tadbSNP:386378366
5144+a, gdbSNP:377164892
5169..5170+, tadbSNP:60929377
5170..5171+, tadbSNP:398021782
5347+a, gdbSNP:259778
5349+a, gdbSNP:17076304
5361+a, gdbSNP:181479847
complement(5526)-t, cdbSNP:148818395
5548+c, gdbSNP:142582476
5739..5740+, tdbSNP:34042420
6059+c, tdbSNP:187578947
6060+c, tdbSNP:150956340
6142+a, cdbSNP:140854224
6161+c, tdbSNP:1047934
6241..6242+, tdbSNP:374839327
6296+g, tdbSNP:202200789
6334+g, tdbSNP:1047936
6386+a, gdbSNP:377226494
6399+c, gdbSNP:375119698
6520+c, tdbSNP:145113739
6662+g, tdbSNP:369271377
6670+c, tdbSNP:117570747
6726+c, tdbSNP:138932325
6788+a, tdbSNP:78022149
6834+c, tdbSNP:116637088
6875+a, gdbSNP:191867357
6969+a, gdbSNP:373567089
7096+g, tdbSNP:182906408
7099+c, tdbSNP:185791087
7202+c, tdbSNP:377414320
7217+c, tdbSNP:140727584
7294+a, gdbSNP:369635821
7297+c, tdbSNP:190255600
7320+a, gdbSNP:59918656
7659+a, gdbSNP:182819882
7669+c, tdbSNP:187105923
7726+c, tdbSNP:370117982
7762+c, gdbSNP:150476408
7788+c, tdbSNP:138167590
7837+a, gdbSNP:116376020
7880+a, gdbSNP:115610469
8037..8038+, adbSNP:35987572
8099+c, tdbSNP:192278120
8116+c, tdbSNP:113193926
8117+a, gdbSNP:111750975
8267+a, cdbSNP:12875896
8272+c, tdbSNP:200743730
8322+a, cdbSNP:183321078
8364+a, gdbSNP:371312428
8444+c, tdbSNP:143315124
8487+c, tdbSNP:375283631
8492+a, gdbSNP:148326472
8507..8510+, ggtcdbSNP:367717423
8541..8542+, cdbSNP:35211768
8541+a, gdbSNP:9509031
8543+a, gdbSNP:368238426
8573+c, tdbSNP:114085584
8691..8692+, tdbSNP:373924644
8720+a, tdbSNP:9509032
8757+g, tdbSNP:202150228
8784..8785+, tdbSNP:35367910
8785..8786+, tdbSNP:386378367
8851+c, gdbSNP:74035911
8889+a, gdbSNP:189125912
8977+g, tdbSNP:71424022
8989+c, tdbSNP:376333313
9051+g, tdbSNP:9509033
9088+c, gdbSNP:193023777
9138+a, gdbSNP:184500081
9204+c, tdbSNP:372967221
9249+c, tdbSNP:189369654
9308+c, tdbSNP:191233361
9322+a, tdbSNP:184104508
9350+a, gdbSNP:188452566
9378+c, gdbSNP:143069637
9381+c, tdbSNP:147196822
9518+a, gdbSNP:140476185
9540+a, tdbSNP:181601105
9544+c, tdbSNP:371666361
9548+a, cdbSNP:113407121
9643+a, gdbSNP:142923297
9754+c, tdbSNP:377582044
9789+a, gdbSNP:370898844
complement(9875)-g, adbSNP:150794326
9893+a, gdbSNP:139064118
9905+c, tdbSNP:149878910
9911+c, gdbSNP:76853155
9958+a, gdbSNP:186596118
9998+c, tdbSNP:371299226
10010..10011+, cagtdbSNP:151013533
10046+c, gdbSNP:116149792
10198+c, tdbSNP:371210963
Gene SymbolZMYM2
Gene SynonymFIM; MYM; RAMP; SCLL; ZNF198
Chromosome13
Locus Map13q11-q12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_197968 Homo sapiens zinc finger, MYM-type 2 (ZMYM2), transcript variant 2, mRNA. On-demand $1699.00 25
NM_001190965 Homo sapiens zinc finger, MYM-type 2 (ZMYM2), transcript variant 4, mRNA. On-demand $1699.00 25
NM_001190964 Homo sapiens zinc finger, MYM-type 2 (ZMYM2), transcript variant 3, mRNA. On-demand $1699.00 25
NM_003453 Homo sapiens zinc finger, MYM-type 2 (ZMYM2), transcript variant 1, mRNA. On-demand $1699.00 25
XM_005266517 PREDICTED: Homo sapiens zinc finger, MYM-type 2 (ZMYM2), transcript variant X2, mRNA. On-demand $1699.00 25
XM_005266520 PREDICTED: Homo sapiens zinc finger, MYM-type 2 (ZMYM2), transcript variant X5, mRNA. On-demand $1699.00 25
XM_005266518 PREDICTED: Homo sapiens zinc finger, MYM-type 2 (ZMYM2), transcript variant X3, mRNA. On-demand $1699.00 25
XM_005266519 PREDICTED: Homo sapiens zinc finger, MYM-type 2 (ZMYM2), transcript variant X4, mRNA. On-demand $1699.00 25
XM_005266521 PREDICTED: Homo sapiens zinc finger, MYM-type 2 (ZMYM2), transcript variant X6, mRNA. On-demand $1699.00 25
XM_006719864 PREDICTED: Homo sapiens zinc finger, MYM-type 2 (ZMYM2), transcript variant X7, mRNA. On-demand $1699.00 25
Title B-lymphoblastic leukemia/lymphoma associated with t(8;13)(p11;q12)/ ZMYM2 (ZNF198)-FGFR1 : rare case and review of the literature .
Author Trimaldi J, Carballido EM, Bowers JW, Anguiano AL, Zhang ZJ, Shah BD, Bruno S, List AF, Moscinski LC, Grady T, Agosti SJ, Kang L and Zhang L.
Journal Acta Haematol. 130 (3), 127-134 (2013)
Title Proteins ZNF198 and SUZ12 are down-regulated in hepatitis B virus (HBV) X protein-mediated hepatocyte transformation and in HBV replication .
Author Wang WH, Studach LL and Andrisani OM.
Journal Hepatology 53 (4), 1137-1147 (2011)
Title Genetic fingerprinting of the development and progression of T-cell lymphoma in a murine model of atypical myeloproliferative disorder initiated by the ZNF198-fibroblast growth factor receptor-1 chimeric tyrosine kinase .
Author Ren M, Li X and Cowell JK.
Journal Blood 114 (8), 1576-1584 (2009)
Title Phosphorylation of the SSBP2 and ABL proteins by the ZNF198-FGFR1 fusion kinase seen in atypical myeloproliferative disorders as revealed by phosphopeptide-specific MS .
Author Kasyapa C, Gu TL, Nagarajan L, Polakiewicz R and Cowell JK.
Journal Proteomics 9 (16), 3979-3988 (2009)
Title ZNF198 stabilizes the LSD1-CoREST-HDAC1 complex on chromatin through its MYM-type zinc fingers .
Author Gocke CB and Yu H.
Journal PLoS ONE 3 (9), E3255 (2008)
Title Consistent fusion of ZNF198 to the fibroblast growth factor receptor-1 in the t(8;13)(p11;q12) myeloproliferative syndrome .
Author Reiter A, Sohal J, Kulkarni S, Chase A, Macdonald DH, Aguiar RC, Goncalves C, Hernandez JM, Jennings BA, Goldman JM and Cross NC.
Journal Blood 92 (5), 1735-1742 (1998)
Title The t(8;13) atypical myeloproliferative disorder: further analysis of the ZNF198 gene and lack of evidence for multiple genes disrupted on chromosome 13 .
Author Still,I.H. and Cowell,J.K.
Journal Blood 92 (4), 1456-1458 (1998)
Title Fibroblast growth factor receptor 1 is fused to FIM in stem-cell myeloproliferative disorder with t(8;13) .
Author Popovici C, Adelaide J, Ollendorff V, Chaffanet M, Guasch G, Jacrot M, Leroux D, Birnbaum D and Pebusque MJ.
Journal Proc. Natl. Acad. Sci. U.S.A. 95 (10), 5712-5717 (1998)
Title The t(8;13)(p11;q11-12) rearrangement associated with an atypical myeloproliferative disorder fuses the fibroblast growth factor receptor 1 gene to a novel gene RAMP .
Author Smedley D, Hamoudi R, Clark J, Warren W, Abdul-Rauf M, Somers G, Venter D, Fagan K, Cooper C and Shipley J.
Journal Hum. Mol. Genet. 7 (4), 637-642 (1998)
Title FGFR1 is fused with a novel zinc-finger gene, ZNF198, in the t(8;13) leukaemia/lymphoma syndrome .
Author Xiao S, Nalabolu SR, Aster JC, Ma J, Abruzzo L, Jaffe ES, Stone R, Weissman SM, Hudson TJ and Fletcher JA.
Journal Nat. Genet. 18 (1), 84-87 (1998)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.