• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens telomerase reverse transcriptase (TERT), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_198253 Homo sapiens telomerase reverse transcriptase (TERT), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $1699.00 25

*Business Day

Related Services

RefSeq Version NM_198253.2, 109633030
Length 4018 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens telomerase reverse transcriptase (TERT), transcript variant 1, mRNA.
Product telomerase reverse transcriptase isoform 1
Comment

Summary: Telomerase is a ribonucleoprotein polymerase that maintains telomere ends by addition of the telomere repeat TTAGGG. The enzyme consists of a protein component with reverse transcriptase activity, encoded by this gene, and an RNA component which serves as a template for the telomere repeat. Telomerase expression plays a role in cellular senescence, as it is normally repressed in postnatal somatic cells resulting in progressive shortening of telomeres. Deregulation of telomerase expression in somatic cells may be involved in oncogenesis. Studies in mouse suggest that telomerase also participates in chromosomal repair, since de novo synthesis of telomere repeats may occur at double-stranded breaks. Alternatively spliced variants encoding different isoforms of telomerase reverse transcriptase have been identified; the full-length sequence of some variants has not been determined. Alternative splicing at this locus is thought to be one mechanism of regulation of telomerase activity. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1).

RefSeq NP_937983.2
CDS 59..3457
Misc Feature(1)59..748
Misc Feature(2)59..748
Misc Feature(3)230..649
Misc Feature(4)467..481
Misc Feature(5)563..565
Misc Feature(6)737..739
Misc Feature(7)749..1030
Misc Feature(8)959..1672
Misc Feature(9)1031..1708
Misc Feature(10)1184..1621
Misc Feature(11)1247..1309
Misc Feature(12)1436..1840
Misc Feature(13)2177..2179
Misc Feature(14)2177..2179
Misc Feature(15)2531..2866
Misc Feature(16)order(2555..2560,2654..2656,2660..2665,2849..2854)
Misc Feature(17)2558..2560
Misc Feature(18)2657..2659
Misc Feature(19)2798..2842
Misc Feature(20)2846..2860
Misc Feature(21)2864..3454
Exon (1)1..277
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Exon (2)278..1631
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Exon (3)1632..1827
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Exon (4)1828..2008
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Exon (5)2009..2188
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Exon (6)2189..2344
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Exon (7)2345..2440
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Exon (8)2441..2526
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Exon (9)2527..2640
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Exon (10)2641..2712
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Exon (11)2713..2901
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Exon (12)2902..3028
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Exon (13)3029..3090
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Exon (14)3091..3215
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Exon (15)3216..3353
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Exon (16)3354..4018
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Translation MPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLVCVPW DARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNVLAFGFALLDGARGGPPEAFTTSVR SYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGA ATQARPPPHASGPRRRLGCERAWNHSVREAGVPLGLPAPGARRRGGSASRSLPLPKRPRR GAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVG RQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRL VETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVT PAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGS RHNERRFLRNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREEI LAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRE LSEAEVRQHREARPALLTSRLRFIPKPDGLRPIVNMDYVVGARTFRREKRAERLTSRVKA LFSVLNYERARRPGLLGASVLGLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTI PQDRLTEVIASIIKPQNTYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHL QETSPLRDAVVIEQSSSLNEASSGLFDVFLRFMCHHAVRIRGKSYVQCQGIPQGSILSTL LCSLCYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVVNL RKTVVNFPVEDEALGGTAFVQMPAHGLFPWCGLLLDTRTLEVQSDYSSYARTSIRASLTF NRGFKAGRNMRRKLFGVLRLKCHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLP FHQQVWKNPTFFLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLL KLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEAAANPALPSDFKTILD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
155+c, tdbSNP:199422289
170+, cdbSNP:199422290
complement(459)-dbSNP:
complement(459)-t, cdbSNP:141125591
complement(461)-t, cdbSNP:200843534
488+a, gdbSNP:199422291
complement(561)-t, adbSNP:139824461
complement(578)-g, cdbSNP:145958962
complement(589)-t, cdbSNP:142489903
complement(630)-g, cdbSNP:11952056
complement(634)-t, cdbSNP:138395366
complement(646..647)-, gdbSNP:147627306
662+a, gdbSNP:121918661
complement(721)-g, adbSNP:35837567
complement(770)-t, gdbSNP:149427814
complement(796)-t, c, adbSNP:111527543
complement(805)-g, cdbSNP:138920650
complement(837)-t, cdbSNP:148798048
complement(843)-t, gdbSNP:150277224
complement(893)-t, cdbSNP:61748181
complement(896)-t, cdbSNP:199701877
complement(911..912)-, adbSNP:145184650
complement(911)-c, adbSNP:138332462
complement(927)-g, adbSNP:147056740
973+a, gdbSNP:2736098
complement(1020)-c, adbSNP:150981755
complement(1021)-c, adbSNP:142595542
complement(1026)-g, cdbSNP:139342764
complement(1027)-t, cdbSNP:148549782
complement(1131)-t, cdbSNP:200191524
complement(1166)-g, adbSNP:143148040
complement(1196)-g, adbSNP:144756946
complement(1231)-g, adbSNP:201505416
complement(1252)-, cdbSNP:67628414
complement(1278)-c, adbSNP:148877257
1292+c, tdbSNP:34094720
complement(1327)-t, gdbSNP:190411812
complement(1395)-t, cdbSNP:111952055
complement(1396)-g, adbSNP:112441737
1436..1438+, cagdbSNP:199422292
complement(1450)-g, adbSNP:186596886
complement(1480)-g, adbSNP:139133620
complement(1489)-g, cdbSNP:35459373
1514+c, tdbSNP:199422293
complement(1523)-t, gdbSNP:201990815
complement(1545)-g, adbSNP:143499386
complement(1552)-t, cdbSNP:200369031
complement(1588)-, cdbSNP:67172607
complement(1605)-t, c, adbSNP:113065975
complement(1622)-t, gdbSNP:200864183
complement(1651)-dbSNP:
complement(1651)-g, adbSNP:146462061
complement(1714)-g, adbSNP:143789839
complement(1717)-t, cdbSNP:35809415
complement(1720)-g, cdbSNP:200539091
complement(1748)-t, adbSNP:140261940
complement(1766..1767)-, tdbSNP:67541672
complement(1789)-g, cdbSNP:143585580
complement(1808)-c, adbSNP:151204682
complement(1809)-c, adbSNP:143457728
complement(1818)-g, adbSNP:148882731
complement(1819)-, adbSNP:66475544
complement(1837)-dbSNP:
complement(1837)-c, adbSNP:199585924
complement(1870)-g, adbSNP:33959226
complement(1894)-g, cdbSNP:34170122
complement(1901)-t, cdbSNP:112614087
complement(1907)-g, adbSNP:140951453
complement(1938)-, gdbSNP:66688792
complement(1938)-g, cdbSNP:146439826
complement(1942)-g, adbSNP:143992655
1950+a, gdbSNP:199422294
complement(1954)-t, cdbSNP:140056333
complement(1973)-t, cdbSNP:151121796
complement(1975)-g, adbSNP:142989562
complement(1989)-g, adbSNP:201927653
complement(1990)-t, cdbSNP:148582238
complement(1994)-g, adbSNP:147521473
complement(1997)-t, gdbSNP:144821759
complement(2007)-t, cdbSNP:190125817
complement(2011)-dbSNP:
complement(2011)-g, adbSNP:201088708
complement(2071)-g, adbSNP:34625402
2087+g, tdbSNP:199422296
complement(2089)-t, cdbSNP:33956095
2103+a, gdbSNP:199422295
complement(2130)-t, cdbSNP:202123213
2138+a, gdbSNP:121918662
2155+c, tdbSNP:33963617
complement(2164)-t, cdbSNP:151055240
2168+c, tdbSNP:199422297
complement(2203)-dbSNP:
complement(2203)-t, gdbSNP:140823760
2205+c, tdbSNP:199422298
complement(2209)-g, adbSNP:147261325
2220+c, gdbSNP:199422299
complement(2235)-g, adbSNP:149566858
2236+a, gdbSNP:199422288
complement(2245)-g, adbSNP:200819224
complement(2248)-g, adbSNP:138128892
complement(2272)-t, cdbSNP:200858212
complement(2279)-t, cdbSNP:150819225
2298+, tdbSNP:199422300
complement(2365)-dbSNP:
complement(2365)-g, adbSNP:117662357
complement(2371)-t, cdbSNP:199770141
2373+a, gdbSNP:121918663
complement(2429)-t, cdbSNP:141425941
complement(2480)-dbSNP:
complement(2480)-t, cdbSNP:200119385
2489+c, tdbSNP:199422301
complement(2533)-dbSNP:
complement(2533)-g, adbSNP:141382603
complement(2575)-t, cdbSNP:140124989
complement(2578)-t, cdbSNP:144310369
2595+a, gdbSNP:199422302
complement(2631)-t, cdbSNP:144779807
2652+dbSNP:
2652+a, gdbSNP:121918666
complement(2657)-c, adbSNP:201159197
2686+c, gdbSNP:199422303
2759+dbSNP:
2759+c, tdbSNP:199422304
2764+c, gdbSNP:121918665
complement(2802)-t, cdbSNP:202033269
complement(2827)-t, cdbSNP:200174990
complement(2833)-t, cdbSNP:34528119
complement(2860)-c, adbSNP:201322872
complement(2871)-t, cdbSNP:199741493
complement(2902)-dbSNP:
complement(2902)-c, adbSNP:34062885
complement(2942)-g, adbSNP:144697790
complement(2945)-t, cdbSNP:201272197
complement(2967)-g, adbSNP:149439946
2993+c, tdbSNP:199422305
complement(3004)-g, adbSNP:201689770
3097+dbSNP:
3097+c, tdbSNP:33954691
3101+c, tdbSNP:199422307
complement(3134)-, adbSNP:67648047
complement(3153)-, adbSNP:67578903
complement(3159)-t, cdbSNP:62331332
complement(3163)-g, adbSNP:181612536
complement(3217)-dbSNP:
complement(3217)-t, cdbSNP:200002330
complement(3222)-g, adbSNP:201330213
complement(3238)-g, adbSNP:202166769
3242+a, gdbSNP:35719940
complement(3244)-g, adbSNP:201067706
complement(3278)-c, adbSNP:201235479
complement(3315)-t, cdbSNP:200288187
3326+a, gdbSNP:121918664
complement(3334..3335)-, gdbSNP:66907572
complement(3382)-dbSNP:
complement(3382)-g, adbSNP:35033501
complement(3384)-t, cdbSNP:185829989
3387+c, tdbSNP:199422306
complement(3391)-t, cdbSNP:200102606
complement(3409)-g, adbSNP:192377676
complement(3462..3638)-dbSNP:199422308
complement(3520)-t, cdbSNP:5031049
complement(3556)-t, cdbSNP:2853690
complement(3600)-g, adbSNP:147703938
complement(3610)-g, adbSNP:114012142
complement(3611)-t, cdbSNP:142869901
complement(3708)-g, adbSNP:34527601
complement(3735)-, adbSNP:67121469
Gene SymbolTERT
Gene SynonymCMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Chromosome5
Locus Map5p15.33
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001193376 Homo sapiens telomerase reverse transcriptase (TERT), transcript variant 2, mRNA. On-demand $1699.00 25
NM_198253 Homo sapiens telomerase reverse transcriptase (TERT), transcript variant 1, mRNA. On-demand $1699.00 25
Title Molecular mechanisms involved in HIV-1-Tat mediated inhibition of telomerase activity in human CD4(+) T lymphocytes .
Author Comandini,A., Naro,C., Adamo,R., Akbar,A.N., Lanna,A., Bonmassar,E. and Franzese,O.
Journal Mol. Immunol. 54 (2), 181-192 (2013)
Title Molecular characterization of chromosomal band 5p15.33: a recurrent breakpoint region in mantle cell lymphoma involving the TERT-CLPTM1L locus .
Author Schilling,G., Penas,E.M., Janjetovic,S., Oliveira-Ferrer,L., Braig,M., Behrmann,P., Bokemeyer,C. and Dierlamm,J.
Journal Leuk. Res. 37 (3), 280-286 (2013)
Title Highly recurrent TERT promoter mutations in human melanoma .
Author Huang,F.W., Hodis,E., Xu,M.J., Kryukov,G.V., Chin,L. and Garraway,L.A.
Journal Science 339 (6122), 957-959 (2013)
Title TERT promoter mutations in familial and sporadic melanoma .
Author Horn,S., Figl,A., Rachakonda,P.S., Fischer,C., Sucker,A., Gast,A., Kadel,S., Moll,I., Nagore,E., Hemminki,K., Schadendorf,D. and Kumar,R.
Journal Science 339 (6122), 959-961 (2013)
Title Identifying familial myelodysplastic/acute leukemia predisposition syndromes through hematopoietic stem cell transplantation donors with thrombocytopenia .
Author Churpek,J.E., Nickels,E., Marquez,R., Rojek,K., Liu,B., Lorenz,R., Lepore,J., Madzo,J., Wickrema,A., Artz,A.S., van Besien,K. and Godley,L.A.
Journal Blood 120 (26), 5247-5249 (2012)
Title Human telomerase contains evolutionarily conserved catalytic and structural subunits .
Author Harrington,L., Zhou,W., McPhail,T., Oulton,R., Yeung,D.S., Mar,V., Bass,M.B. and Robinson,M.O.
Journal Genes Dev. 11 (23), 3109-3115 (1997)
Title Isolation of a candidate human telomerase catalytic subunit gene, which reveals complex splicing patterns in different cell types .
Author Kilian,A., Bowtell,D.D., Abud,H.E., Hime,G.R., Venter,D.J., Keese,P.K., Duncan,E.L., Reddel,R.R. and Jefferson,R.A.
Journal Hum. Mol. Genet. 6 (12), 2011-2019 (1997)
Title hEST2, the putative human telomerase catalytic subunit gene, is up-regulated in tumor cells and during immortalization .
Author Meyerson,M., Counter,C.M., Eaton,E.N., Ellisen,L.W., Steiner,P., Caddle,S.D., Ziaugra,L., Beijersbergen,R.L., Davidoff,M.J., Liu,Q., Bacchetti,S., Haber,D.A. and Weinberg,R.A.
Journal Cell 90 (4), 785-795 (1997)
Title Telomerase catalytic subunit homologs from fission yeast and human .
Author Nakamura,T.M., Morin,G.B., Chapman,K.B., Weinrich,S.L., Andrews,W.H., Lingner,J., Harley,C.B. and Cech,T.R.
Journal Science 277 (5328), 955-959 (1997)
Title Reverse transcriptase motifs in the catalytic subunit of telomerase .
Author Lingner,J., Hughes,T.R., Shevchenko,A., Mann,M., Lundblad,V. and Cech,T.R.
Journal Science 276 (5312), 561-567 (1997)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.