• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens telomerase reverse transcriptase (TERT), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu25394 Homo sapiens telomerase reverse transcriptase (TERT), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $1699.00 25
OHu25394C Homo sapiens telomerase reverse transcriptase (TERT), transcript variant 1, mRNA. Customized vector On-demand $1699.00 25

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_198253.2, 109633030
Length 3399 bp
Structure linear
Update Date 18-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens telomerase reverse transcriptase (TERT), transcript variant 1, mRNA.
Product telomerase reverse transcriptase isoform 1
Comment

Summary: Telomerase is a ribonucleoprotein polymerase that maintains telomere ends by addition of the telomere repeat TTAGGG. The enzyme consists of a protein component with reverse transcriptase activity, encoded by this gene, and an RNA component which serves as a template for the telomere repeat. Telomerase expression plays a role in cellular senescence, as it is normally repressed in postnatal somatic cells resulting in progressive shortening of telomeres. Deregulation of telomerase expression in somatic cells may be involved in oncogenesis. Studies in mouse suggest that telomerase also participates in chromosomal repair, since de novo synthesis of telomere repeats may occur at double-stranded breaks. Alternatively spliced variants encoding different isoforms of telomerase reverse transcriptase have been identified; the full-length sequence of some variants has not been determined. Alternative splicing at this locus is thought to be one mechanism of regulation of telomerase activity. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1).

RefSeq NP_937983.2
CDS 59..3457
Misc Feature(1)59..748
Misc Feature(2)59..748
Misc Feature(3)230..649
Misc Feature(4)467..481
Misc Feature(5)563..565
Misc Feature(6)722..778
Misc Feature(7)737..739
Misc Feature(8)737..739
Misc Feature(9)749..1030
Misc Feature(10)959..1672
Misc Feature(11)1031..1708
Misc Feature(12)1184..1621
Misc Feature(13)1247..1309
Misc Feature(14)1427..1429
Misc Feature(15)1436..1840
Misc Feature(16)1910..>2245
Misc Feature(17)2177..2179
Misc Feature(18)2177..2179
Misc Feature(19)2192..2209
Misc Feature(20)2531..2866
Misc Feature(21)order(2555..2560,2654..2656,2660..2665,2849..2854)
Misc Feature(22)2558..2560
Misc Feature(23)2657..2659
Misc Feature(24)2798..2842
Misc Feature(25)2846..2860
Misc Feature(26)2864..3454
Exon (1)1..277
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Exon (2)278..1631
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Exon (3)1632..1827
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Exon (4)1828..2008
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Exon (5)2009..2188
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Exon (6)2189..2344
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Exon (7)2345..2440
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Exon (8)2441..2526
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Exon (9)2527..2640
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Exon (10)2641..2712
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Exon (11)2713..2901
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Exon (12)2902..3028
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Exon (13)3029..3090
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Exon (14)3091..3215
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Exon (15)3216..3353
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Exon (16)3354..4018
Gene:TERT
Gene Synonym:CMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Translation MPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLVCVPW DARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNVLAFGFALLDGARGGPPEAFTTSVR SYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGA ATQARPPPHASGPRRRLGCERAWNHSVREAGVPLGLPAPGARRRGGSASRSLPLPKRPRR GAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVG RQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRL VETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVT PAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGS RHNERRFLRNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREEI LAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRE LSEAEVRQHREARPALLTSRLRFIPKPDGLRPIVNMDYVVGARTFRREKRAERLTSRVKA LFSVLNYERARRPGLLGASVLGLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTI PQDRLTEVIASIIKPQNTYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHL QETSPLRDAVVIEQSSSLNEASSGLFDVFLRFMCHHAVRIRGKSYVQCQGIPQGSILSTL LCSLCYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVVNL RKTVVNFPVEDEALGGTAFVQMPAHGLFPWCGLLLDTRTLEVQSDYSSYARTSIRASLTF NRGFKAGRNMRRKLFGVLRLKCHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLP FHQQVWKNPTFFLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLL KLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEAAANPALPSDFKTILD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
155+c, tdbSNP:199422289
170+, cdbSNP:199422290
222+a, tdbSNP:387907247
complement(280)-dbSNP:
complement(280)-t, cdbSNP:373356928
complement(459)-t, cdbSNP:141125591
complement(461)-t, cdbSNP:200843534
488+a, gdbSNP:199422291
complement(539)-g, adbSNP:368291455
complement(561)-t, adbSNP:139824461
566+a, gdbSNP:387907248
complement(578)-g, cdbSNP:145958962
complement(589)-t, cdbSNP:142489903
complement(592)-g, adbSNP:370420108
complement(626)-t, cdbSNP:377016753
complement(630)-g, cdbSNP:11952056
complement(634)-t, cdbSNP:138395366
complement(646..647)-, gdbSNP:147627306
721+a, gdbSNP:35837567
complement(770)-t, gdbSNP:149427814
complement(795)-g, adbSNP:377315722
complement(796)-t, c, adbSNP:111527543
complement(805)-g, cdbSNP:138920650
complement(837)-t, cdbSNP:148798048
complement(843)-t, gdbSNP:150277224
complement(861)-t, cdbSNP:374426285
complement(868)-g, adbSNP:369812320
complement(892)-t, gdbSNP:375423906
complement(893)-t, cdbSNP:61748181
complement(896)-t, cdbSNP:199701877
complement(909..910)-, adbSNP:145184650
complement(911)-c, adbSNP:138332462
complement(913)-t, cdbSNP:372185671
complement(927)-g, adbSNP:147056740
complement(943)-g, adbSNP:367957748
complement(965)-t, gdbSNP:376074999
complement(1020)-c, adbSNP:150981755
complement(1021)-c, adbSNP:142595542
complement(1026)-g, cdbSNP:139342764
complement(1027)-t, cdbSNP:148549782
complement(1037)-g, cdbSNP:371457181
complement(1090)-g, cdbSNP:367668700
complement(1131)-t, cdbSNP:200191524
complement(1138)-g, cdbSNP:374549447
complement(1166)-g, adbSNP:143148040
complement(1196)-g, adbSNP:144756946
complement(1222)-t, cdbSNP:377477531
complement(1231)-g, adbSNP:201505416
complement(1259)-c, adbSNP:370887827
complement(1278)-c, adbSNP:148877257
complement(1327)-t, gdbSNP:190411812
complement(1328)-t, cdbSNP:374180689
complement(1381..1383)-, tccdbSNP:377639087
complement(1395)-t, cdbSNP:111952055
complement(1396)-g, adbSNP:112441737
1436..1438+, cagdbSNP:199422292
complement(1450)-g, adbSNP:186596886
complement(1480)-g, adbSNP:139133620
complement(1489)-g, cdbSNP:35459373
1514+c, tdbSNP:199422293
complement(1523)-t, gdbSNP:201990815
complement(1545)-g, adbSNP:143499386
complement(1552)-t, cdbSNP:200369031
complement(1605)-t, c, adbSNP:113065975
complement(1622)-t, gdbSNP:200864183
complement(1647)-dbSNP:
complement(1647)-g, adbSNP:369539932
complement(1651)-g, adbSNP:146462061
complement(1714)-g, adbSNP:143789839
complement(1717)-t, cdbSNP:35809415
complement(1720)-g, cdbSNP:200539091
complement(1748)-t, adbSNP:140261940
complement(1750)-t, cdbSNP:377217777
complement(1789)-g, cdbSNP:143585580
complement(1808)-c, adbSNP:151204682
complement(1809)-c, adbSNP:143457728
complement(1818)-g, adbSNP:148882731
complement(1837)-dbSNP:
complement(1837)-c, adbSNP:199585924
complement(1849)-t, cdbSNP:377106279
complement(1854)-t, cdbSNP:372511089
complement(1870)-g, adbSNP:33959226
complement(1879)-t, cdbSNP:368309861
1894+c, gdbSNP:34170122
complement(1901)-t, cdbSNP:112614087
complement(1907)-g, adbSNP:140951453
complement(1938)-g, cdbSNP:146439826
complement(1942)-g, adbSNP:143992655
1950+a, gdbSNP:199422294
complement(1954)-t, cdbSNP:140056333
complement(1973)-t, cdbSNP:151121796
complement(1975)-g, adbSNP:142989562
complement(1989)-g, adbSNP:201927653
complement(1990)-t, cdbSNP:148582238
complement(1994)-g, adbSNP:147521473
complement(1997)-t, gdbSNP:144821759
complement(2007)-t, cdbSNP:190125817
complement(2011)-dbSNP:
complement(2011)-g, adbSNP:201088708
complement(2015)-g, adbSNP:372272356
complement(2026)-t, cdbSNP:368784316
complement(2041)-t, cdbSNP:375454175
complement(2063)-g, adbSNP:372140951
2071+a, gdbSNP:34625402
complement(2072)-g, adbSNP:368430301
2087+g, tdbSNP:199422296
complement(2089)-t, cdbSNP:33956095
2103+a, gdbSNP:199422295
complement(2119)-g, adbSNP:370486790
complement(2130)-t, cdbSNP:202123213
complement(2137)-g, adbSNP:371759577
2138+a, gdbSNP:121918662
complement(2149)-t, cdbSNP:377436842
complement(2164)-t, cdbSNP:151055240
2168+c, tdbSNP:199422297
complement(2176)-t, cdbSNP:377030225
2204+dbSNP:
2204+a, gdbSNP:387907249
2205+c, tdbSNP:199422298
complement(2209)-g, adbSNP:147261325
complement(2212)-g, adbSNP:377437136
complement(2216)-t, cdbSNP:373072850
2220+c, gdbSNP:199422299
complement(2227)-g, adbSNP:368762140
complement(2235)-g, adbSNP:149566858
2236+a, gdbSNP:199422288
complement(2245)-g, adbSNP:200819224
complement(2248)-g, adbSNP:138128892
complement(2272)-t, cdbSNP:200858212
complement(2279)-t, cdbSNP:150819225
2298+, tdbSNP:199422300
complement(2313)-t, cdbSNP:375699185
complement(2325)-t, cdbSNP:374206276
complement(2341)-g, adbSNP:370808390
complement(2359)-dbSNP:
complement(2359)-t, cdbSNP:374592280
complement(2365)-g, adbSNP:117662357
complement(2371)-t, cdbSNP:199770141
2373+a, gdbSNP:121918663
complement(2426)-t, cdbSNP:371413388
complement(2428)-g, adbSNP:376251639
complement(2429)-t, cdbSNP:141425941
complement(2445)-dbSNP:
complement(2445)-g, adbSNP:369810792
complement(2449)-g, cdbSNP:377216965
complement(2476)-g, adbSNP:372497245
complement(2480)-t, cdbSNP:200119385
2489+c, tdbSNP:199422301
complement(2506)-g, adbSNP:368279364
complement(2533)-dbSNP:
complement(2533)-g, adbSNP:141382603
complement(2569)-g, adbSNP:374940572
complement(2575)-t, cdbSNP:140124989
complement(2578)-t, cdbSNP:144310369
2595+a, gdbSNP:199422302
complement(2615)-g, adbSNP:375042320
complement(2631)-t, cdbSNP:144779807
complement(2651)-dbSNP:
complement(2651)-g, adbSNP:372868296
2652+a, gdbSNP:121918666
complement(2657)-t, c, adbSNP:201159197
2686+c, gdbSNP:199422303
complement(2701)-t, cdbSNP:375558251
complement(2710)-g, adbSNP:374309472
complement(2716)-dbSNP:
complement(2716)-t, gdbSNP:371744235
complement(2746)-g, adbSNP:373952421
2759+c, tdbSNP:199422304
2763+a, gdbSNP:387907250
2764+c, gdbSNP:121918665
complement(2802)-t, cdbSNP:202033269
complement(2809)-t, cdbSNP:375200599
2826+c, tdbSNP:387907251
complement(2827)-t, cdbSNP:200174990
complement(2830)-g, adbSNP:367672336
complement(2833)-t, cdbSNP:34528119
complement(2839)-t, cdbSNP:370292237
complement(2854)-t, gdbSNP:375675196
complement(2860)-c, adbSNP:201322872
complement(2871)-t, cdbSNP:199741493
complement(2902)-dbSNP:
complement(2902)-c, adbSNP:34062885
complement(2909)-t, gdbSNP:370445231
complement(2942)-g, adbSNP:144697790
complement(2945)-t, cdbSNP:201272197
complement(2967)-g, adbSNP:149439946
2993+c, tdbSNP:199422305
complement(3004)-g, adbSNP:201689770
complement(3049)-dbSNP:
complement(3049)-t, cdbSNP:376266401
3097+dbSNP:
3097+c, tdbSNP:33954691
3101+c, tdbSNP:199422307
complement(3147)-g, cdbSNP:377419542
complement(3159)-t, cdbSNP:62331332
complement(3161)-t, cdbSNP:374968697
complement(3163)-g, adbSNP:181612536
complement(3184)-g, adbSNP:377570406
complement(3208)-g, cdbSNP:373400596
complement(3217)-dbSNP:
complement(3217)-t, cdbSNP:200002330
complement(3222)-g, adbSNP:201330213
complement(3238)-g, adbSNP:202166769
3242+a, gdbSNP:35719940
complement(3244)-g, adbSNP:201067706
complement(3265)-g, adbSNP:376835357
complement(3278)-c, adbSNP:201235479
complement(3315)-t, cdbSNP:200288187
3326+a, gdbSNP:121918664
complement(3334)-g, adbSNP:368551449
complement(3381)-dbSNP:
complement(3381)-g, adbSNP:376255453
complement(3382)-g, adbSNP:35033501
complement(3384)-t, cdbSNP:185829989
3387+c, tdbSNP:199422306
complement(3390)-g, adbSNP:370686937
complement(3391)-t, cdbSNP:200102606
complement(3408)-t, gdbSNP:372822033
complement(3409)-g, adbSNP:192377676
3462..3638+dbSNP:199422308
complement(3466)-g, adbSNP:374834138
complement(3520)-t, cdbSNP:5031049
complement(3556)-t, cdbSNP:2853690
complement(3595)-g, adbSNP:376258654
complement(3600)-g, adbSNP:147703938
complement(3610)-g, adbSNP:114012142
complement(3611)-t, cdbSNP:142869901
3708+a, gdbSNP:34527601
complement(3708)-g, adbSNP:386582629
complement(3712)-t, cdbSNP:373241100
complement(3726)-t, cdbSNP:369456871
complement(3792)-t, cdbSNP:375391845
Gene SymbolTERT
Gene SynonymCMM9; DKCA2; DKCB4; EST2; hEST2; hTRT; PFBMFT1; TCS1; TP2; TRT
Chromosome5
Locus Map5p15.33
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001193376 Homo sapiens telomerase reverse transcriptase (TERT), transcript variant 2, mRNA. On-demand $1699.00 25
NM_198253 Homo sapiens telomerase reverse transcriptase (TERT), transcript variant 1, mRNA. On-demand $1699.00 25
Title The absence of TERT promoter mutations in primary gastric cancer .
Author Liu T, Liang X, Bjorkholm M, Jia J and Xu D.
Journal Gene 540 (2), 266-267 (2014)
Title Telomerase functions beyond telomere maintenance in primary cutaneous T-cell lymphoma .
Author Chevret E, Andrique L, Prochazkova-Carlotti M, Ferrer J, Cappellen D, Laharanne E, Idrissi Y, Boettiger A, Sahraoui W, Ruiz F, Pham-Ledard A, Vergier B, Belloc F, Dubus P, Beylot-Barry M and Merlio JP.
Journal Blood 123 (12), 1850-1859 (2014)
Title Noncanonical functions of telomerase: implications in telomerase-targeted cancer therapies .
Author Li Y and Tergaonkar V.
Journal Cancer Res. 74 (6), 1639-1644 (2014)
Title Telomere length and telomerase reverse transcriptase mRNA expression in patients with hepatitis C .
Author Biron-Shental,T., Amiel,A., Anchidin,R., Sharony,R., Hadary,R. and Kitay-Cohen,Y.
Journal Hepatogastroenterology 60 (127), 1713-1716 (2013)
Title Isolation of a candidate human telomerase catalytic subunit gene, which reveals complex splicing patterns in different cell types .
Author Kilian A, Bowtell DD, Abud HE, Hime GR, Venter DJ, Keese PK, Duncan EL, Reddel RR and Jefferson RA.
Journal Hum. Mol. Genet. 6 (12), 2011-2019 (1997)
Title hEST2, the putative human telomerase catalytic subunit gene, is up-regulated in tumor cells and during immortalization .
Author Meyerson M, Counter CM, Eaton EN, Ellisen LW, Steiner P, Caddle SD, Ziaugra L, Beijersbergen RL, Davidoff MJ, Liu Q, Bacchetti S, Haber
Journal Cell 90 (4), 785-795 (1997)
Title Telomerase catalytic subunit homologs from fission yeast and human .
Author Nakamura TM, Morin GB, Chapman KB, Weinrich SL, Andrews WH, Lingner J, Harley CB and Cech TR.
Journal Science 277 (5328), 955-959 (1997)
Title Reverse transcriptase motifs in the catalytic subunit of telomerase .
Author Lingner J, Hughes TR, Shevchenko A, Mann M, Lundblad V and Cech TR.
Journal Science 276 (5312), 561-567 (1997)
Title Dyskeratosis Congenita .
Author Savage,S.A.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Pulmonary Fibrosis, Familial .
Author Talbert,J.L. and Schwartz,D.A.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.