• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens leucine-rich repeat kinase 2 (LRRK2), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu46306 Homo sapiens leucine-rich repeat kinase 2 (LRRK2), mRNA. pcDNA3.1+-DYK On-demand $3749.00 35
OHu46306C Homo sapiens leucine-rich repeat kinase 2 (LRRK2), mRNA. Customized vector On-demand $3749.00 35

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_198578.3, 171846277
Length 7584 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens leucine-rich repeat kinase 2 (LRRK2), mRNA.
Product leucine-rich repeat serine/threonine-protein kinase 2
Comment

Summary: This gene is a member of the leucine-rich repeat kinase family and encodes a protein with an ankryin repeat region, a leucine-rich repeat (LRR) domain, a kinase domain, a DFG-like motif, a RAS domain, a GTPase domain, a MLK-like domain, and a WD40 domain. The protein is present largely in the cytoplasm but also associates with the mitochondrial outer membrane. Mutations in this gene have been associated with Parkinson disease-8. [provided by RefSeq, Jul 2008].

RefSeq NP_940980.3
CDS 122..7705
Misc Feature(1)23..25
Misc Feature(2)2258..2500
Misc Feature(3)2258..2500
Misc Feature(4)3068..3133
Misc Feature(5)3071..3262
Misc Feature(6)3077..3745
Misc Feature(7)order(3080..3082,3086..3088,3095..3097,3101..3103,
Misc Feature(8)3155..3220
Misc Feature(9)order(3176..3181,3320..3322,3467..3469,3533..3535,
Misc Feature(10)3227..3292
Misc Feature(11)3296..3361
Misc Feature(12)3371..3436
Misc Feature(13)3443..3508
Misc Feature(14)3509..3571
Misc Feature(15)3638..3817
Misc Feature(16)3641..3709
Misc Feature(17)3710..3775
Misc Feature(18)3782..3955
Misc Feature(19)3782..3844
Misc Feature(20)3857..3922
Misc Feature(21)3926..3994
Misc Feature(22)4118..>4504
Misc Feature(23)4121..4642
Misc Feature(24)4142..4165
Misc Feature(25)order(4157..4168,4310..4312,4475..4480,4484..4486,
Misc Feature(26)4223..4225
Misc Feature(27)4235..4243
Misc Feature(28)4301..4312
Misc Feature(29)order(4307..4312,4358..4363)
Misc Feature(30)4475..4486
Misc Feature(31)4586..4594
Misc Feature(32)5771..6505
Misc Feature(33)5774..6517
Misc Feature(34)order(5774..5788,5798..5800,5831..5833,5837..5839,
Misc Feature(35)order(5774..5788,5798..5800,5831..5833,5837..5839,
Misc Feature(36)order(5786..5788,5981..5983,5987..5989,6101..6103,
Misc Feature(37)order(6167..6187,6221..6232)
Misc Feature(38)<6623..7276
Misc Feature(39)order(6632..6634,6644..6646,6665..6670,6701..6706,
Exon (1)1..272
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (2)273..358
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (3)359..468
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (4)469..557
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (5)558..692
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (6)693..827
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (7)828..959
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (8)960..1079
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (9)1080..1222
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (10)1223..1302
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (11)1303..1409
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (12)1410..1539
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (13)1540..1664
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (14)1665..1777
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (15)1778..1922
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (16)1923..2062
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (17)2063..2191
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (18)2192..2362
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (19)2363..2621
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (20)2622..2810
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (21)2811..2929
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (22)2930..2999
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (23)3000..3217
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (24)3218..3468
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (25)3469..3617
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (26)3618..3711
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (27)3712..3898
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (28)3899..4080
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (29)4081..4310
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (30)4311..4438
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (31)4439..4657
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (32)4658..4859
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (33)4860..4948
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (34)4949..5136
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (35)5137..5291
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (36)5292..5438
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (37)5439..5630
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (38)5631..5777
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (39)5778..5878
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (40)5879..6069
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (41)6070..6230
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (42)6231..6401
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (43)6402..6502
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (44)6503..6697
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (45)6698..6891
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (46)6892..6964
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (47)6965..7149
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (48)7150..7302
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (49)7303..7511
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (50)7512..7583
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Exon (51)7584..9225
Gene:LRRK2
Gene Synonym:AURA17; DARDARIN; PARK8; RIPK7; ROCO2
Translation MASGSCQGCEEDEETLKKLIVRLNNVQEGKQIETLVQILEDLLVFTYSEHASKLFQGKNI HVPLLIVLDSYMRVASVQQVGWSLLCKLIEVCPGTMQSLMGPQDVGNDWEVLGVHQLILK MLTVHNASVNLSVIGLKTLDLLLTSGKITLLILDEESDIFMLIFDAMHSFPANDEVQKLG CKALHVLFERVSEEQLTEFVENKDYMILLSALTNFKDEEEIVLHVLHCLHSLAIPCNNVE VLMSGNVRCYNIVVEAMKAFPMSERIQEVSCCLLHRLTLGNFFNILVLNEVHEFVVKAVQ QYPENAALQISALSCLALLTETIFLNQDLEEKNENQENDDEGEEDKLFWLEACYKALTWH RKNKHVQEAACWALNNLLMYQNSLHEKIGDEDGHFPAHREVMLSMLMHSSSKEVFQASAN ALSTLLEQNVNFRKILLSKGIHLNVLELMQKHIHSPEVAESGCKMLNHLFEGSNTSLDIM AAVVPKILTVMKRHETSLPVQLEALRAILHFIVPGMPEESREDTEFHHKLNMVKKQCFKN DIHKLVLAALNRFIGNPGIQKCGLKVISSIVHFPDALEMLSLEGAMDSVLHTLQMYPDDQ EIQCLGLSLIGYLITKKNVFIGTGHLLAKILVSSLYRFKDVAEIQTKGFQTILAILKLSA SFSKLLVHHSFDLVIFHQMSSNIMEQKDQQFLNLCCKCFAKVAMDDYLKNVMLERACDQN NSIMVECLLLLGADANQAKEGSSLICQVCEKESSPKLVELLLNSGSREQDVRKALTISIG KGDSQIISLLLRRLALDVANNSICLGGFCIGKVEPSWLGPLFPDKTSNLRKQTNIASTLA RMVIRYQMKSAVEEGTASGSDGNFSEDVLSKFDEWTFIPDSSMDSVFAQSDDLDSEGSEG SFLVKKKSNSISVGEFYRDAVLQRCSPNLQRHSNSLGPIFDHEDLLKRKRKILSSDDSLR SSKLQSHMRHSDSISSLASEREYITSLDLSANELRDIDALSQKCCISVHLEHLEKLELHQ NALTSFPQQLCETLKSLTHLDLHSNKFTSFPSYLLKMSCIANLDVSRNDIGPSVVLDPTV KCPTLKQFNLSYNQLSFVPENLTDVVEKLEQLILEGNKISGICSPLRLKELKILNLSKNH ISSLSENFLEACPKVESFSARMNFLAAMPFLPPSMTILKLSQNKFSCIPEAILNLPHLRS LDMSSNDIQYLPGPAHWKSLNLRELLFSHNQISILDLSEKAYLWSRVEKLHLSHNKLKEI PPEIGCLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDELHLNFDFKHIGCKAKDIIR FLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKTKKSDLGMQSATVGIDVKDWPIQI RDKRKRDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKA RASSSPVILVGTHLDVSDEKQRKACMSKITKELLNKRGFPAIRDYHFVNATEESDALAKL RKTIINESLNFKIRDQLVVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVREN QLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEGCPK HPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVI ELPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPYMLSGRERALRPNRMYWRQGIYL NWSPEAYCLVGSEVLDNHPESFLKITVPSCRKGCILLGQVVDHIDSLMEEWFPGLLEIDI CGEGETLLKKWALYSFNDGEEHQKILLDDLMKKAEEGDLLVNPDQPRLTIPISQIAPDLI LADLPRNIMLNNDELEFEQAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQE LVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVAD GLRYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRA PEVARGNVIYNQQADVYSFGLLLYDILTTGGRIVEGLKFPNEFDELEIQGKLPDPVKEYG CAPWPMVEKLIKQCLKENPQERPTSAQVFDILNSAELVCLTRRILLPKNVIVECMVATHH NSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQ SGTLLVINTEDGKKRHTLEKMTDSVTCLYCNSFSKQSKQKNFLLVGTADGKLAIFEDKTV KLKGAAPLKILNIGNVSTPLMCLSESTNSTERNVMWGGCGTKIFSFSNDFTIQKLIETRT SQLFSYAAFSDSNIITVVVDTALYIAKQNSPVVEVWDKKTEKLCGLIDCVHFLREVMVKE NKESKHKMSYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRLIRVIYNFCNSVRVMMT AQLGSLKNVMLVLGYNRKNTEGTQKQKEIQSCLTVWDINLPHEVQNLEKHIEVRKELAEK MRRTSVE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
1+dbSNP:
1+g, tdbSNP:199955454
14+c, gdbSNP:71449755
35+c, tdbSNP:201321281
51+g, tdbSNP:200678517
69+a, tdbSNP:41286472
90+a, gdbSNP:144990030
92+c, gdbSNP:72546314
101+a, gdbSNP:41286470
107+a, gdbSNP:71449756
146+g, tdbSNP:200688492
149+a, gdbSNP:281865040
166+c, tdbSNP:142399623
187+a, gdbSNP:151283507
complement(251)-t, gdbSNP:77507662
270+a, gdbSNP:2256408
276+dbSNP:
276+c, tdbSNP:72546335
279+a, gdbSNP:202157354
290+a, gdbSNP:370488844
298+a, tdbSNP:150422099
346+a, gdbSNP:75054132
374+dbSNP:
374+c, tdbSNP:367710346
428+a, cdbSNP:201906467
430+c, gdbSNP:200926937
433+a, tdbSNP:199811736
434+g, tdbSNP:199583240
440+a, gdbSNP:141177841
445+c, tdbSNP:375647996
453+c, tdbSNP:200789262
459+g, tdbSNP:199717383
465+a, cdbSNP:201439315
468+a, gdbSNP:144883021
470+dbSNP:
470+c, tdbSNP:202007707
477+c, tdbSNP:33995463
485+c, tdbSNP:41286468
503+a, gdbSNP:187299177
516+c, tdbSNP:148014807
567+dbSNP:
567+c, gdbSNP:199567598
578+c, tdbSNP:10878245
582+a, gdbSNP:200689827
619+c, tdbSNP:147157307
621+g, tdbSNP:201411683
622+a, gdbSNP:199584795
639+a, gdbSNP:201415714
647+c, gdbSNP:200861326
660+c, gdbSNP:199807643
662+a, tdbSNP:199626351
667+a, gdbSNP:35517158
708+dbSNP:
708+g, tdbSNP:201090840
726+a, gdbSNP:377550083
727+c, tdbSNP:199854074
732+a, tdbSNP:140300473
745+a, g, tdbSNP:111655870
753+c, tdbSNP:112794616
754+c, gdbSNP:199915040
804+c, gdbSNP:56108242
812+c, tdbSNP:201332859
819+c, tdbSNP:377217716
834+dbSNP:
834+a, tdbSNP:28365216
847+c, tdbSNP:201803678
857+a, cdbSNP:150050676
871+c, tdbSNP:139971538
877+c, tdbSNP:200006488
897+a, cdbSNP:199557665
898+a, gdbSNP:369240709
905+a, gdbSNP:182233369
923+c, gdbSNP:201298800
924+a, cdbSNP:373254349
946+a, c, tdbSNP:72546315
955+a, gdbSNP:199626996
971+dbSNP:
971+a, gdbSNP:377312433
977+c, gdbSNP:200437744
988+c, tdbSNP:17490713
989+a, gdbSNP:201159244
992+a, gdbSNP:199981482
1010+a, gdbSNP:199552001
1014+c, tdbSNP:281865059
1015+c, tdbSNP:57355477
1035+a, cdbSNP:201334964
1057+g, tdbSNP:41286466
1121+dbSNP:
1121+a, gdbSNP:78501232
1129+a, gdbSNP:199981130
1147+a, gdbSNP:201322917
1158+a, cdbSNP:368123045
1167+g, tdbSNP:200680138
1176+, cdbSNP:36016791
1185+a, gdbSNP:146562427
1194+c, tdbSNP:141262110
1198+g, tdbSNP:201546601
1209+a, gdbSNP:72546336
1213+a, gdbSNP:200462425
1216+c, tdbSNP:144975499
1217+a, gdbSNP:113065049
1228+dbSNP:
1228+a, c, tdbSNP:201261152
1229+a, gdbSNP:200189771
1238+a, gdbSNP:202170315
1253+c, tdbSNP:200870486
1256+a, gdbSNP:201171722
1261+c, tdbSNP:200440892
1275+a, gdbSNP:201929195
1313+dbSNP:
1313+c, tdbSNP:146765799
1330+c, tdbSNP:200920379
1351+a, cdbSNP:376621322
1355+a, gdbSNP:200043889
1376+a, gdbSNP:201457113
1377+c, tdbSNP:34594498
1378+a, gdbSNP:200357353
1391+a, gdbSNP:202171494
1426+dbSNP:
1426+a, gdbSNP:71653637
1431+c, tdbSNP:200035812
1444+a, gdbSNP:201439614
1476+a, gdbSNP:368389682
1494+c, tdbSNP:200308266
1503+g, tdbSNP:372415323
1504+c, tdbSNP:35847451
1508..1509+, gdbSNP:150246989
1510+g, tdbSNP:79656150
1553+dbSNP:
1553+a, gdbSNP:56001713
1585+a, tdbSNP:75711334
1594+g, tdbSNP:200955457
1598+c, tdbSNP:199954611
1614+c, tdbSNP:201629713
1632+c, tdbSNP:201333920
1633+a, gdbSNP:200022961
1637+c, tdbSNP:150368439
1638+a, gdbSNP:202009639
1640+a, gdbSNP:373935066
1641+c, gdbSNP:200618023
1663..1664+, gdbSNP:34090008
1663+c, tdbSNP:376187481
1682+dbSNP:
1682+a, gdbSNP:35328937
1718+a, gdbSNP:267603454
1736+a, cdbSNP:200634016
1737+a, gdbSNP:55968234
1751+a, gdbSNP:79996249
1774+c, gdbSNP:386453165
1782+c, tdbSNP:149499327
1795+a, gdbSNP:77424631
1810+a, gdbSNP:373490592
1861+a, tdbSNP:145906734
1863+c, tdbSNP:202191866
1866+c, tdbSNP:79299560
1938+dbSNP:
1938+a, gdbSNP:138717506
1943+a, cdbSNP:201131172
1946+c, gdbSNP:142717718
1957+c, tdbSNP:201593147
1968+a, gdbSNP:281865042
1976+g, tdbSNP:55987538
1992+a, gdbSNP:371585650
1995+a, gdbSNP:200787476
2026+a, gdbSNP:200024343
2040+a, cdbSNP:202013032
complement(2063)-dbSNP:
complement(2063)-t, gdbSNP:76943330
2108+c, tdbSNP:78154388
2119+c, gdbSNP:200421434
2124+a, gdbSNP:376731129
2143+a, cdbSNP:72546319
2146+a, gdbSNP:201162329
2159+a, tdbSNP:148395944
2166+a, gdbSNP:190631149
2167+a, tdbSNP:199987713
2176+a, gdbSNP:371781819
2177+c, tdbSNP:202039763
2193+dbSNP:
2193+c, tdbSNP:372875244
2213+c, tdbSNP:201326926
2218+c, tdbSNP:200680745
2234+c, g, tdbSNP:374715956
2241+a, gdbSNP:199843822
2242+c, tdbSNP:201548169
2244..2245+, adbSNP:35611877
2248+a, cdbSNP:200697712
2255+a, gdbSNP:199566791
2258+c, gdbSNP:201532214
2268+c, tdbSNP:281865043
2269+a, gdbSNP:200459681
2272+c, tdbSNP:199614089
2280+a, gdbSNP:71653639
2288+a, gdbSNP:10878307
2293+a, gdbSNP:180861646
2310+c, tdbSNP:202172700
2312+c, tdbSNP:201126499
2333+a, gdbSNP:144393152
2350+g, tdbSNP:200425243
2367+dbSNP:
2367+a, gdbSNP:200867751
2377+a, gdbSNP:377047630
2383+a, tdbSNP:199929255
2385+c, tdbSNP:34410987
2392+a, gdbSNP:200848928
2413+c, tdbSNP:190597533
2420+c, tdbSNP:201823680
2421+a, gdbSNP:200861727
2432+a, gdbSNP:371316424
2435+c, tdbSNP:376015112
2442+c, tdbSNP:368291361
2443+a, gdbSNP:146103273
2449+a, gdbSNP:201443306
2452+a, tdbSNP:200312137
2457+c, tdbSNP:199585357
2460+a, gdbSNP:201537658
2473+a, cdbSNP:398124660
2491+c, tdbSNP:200463556
2499+g, tdbSNP:35173587
2500+a, gdbSNP:200235844
2501+c, tdbSNP:143619089
2506+c, tdbSNP:201177991
2549+a, gdbSNP:72546337
2602+c, tdbSNP:76890302
2603+a, tdbSNP:200251719
2624+dbSNP:
2624+a, gdbSNP:200557762
2628+c, tdbSNP:201806052
2629+a, gdbSNP:148920013
2662+c, g, tdbSNP:77692505
2666+a, gdbSNP:201935073
2673+c, tdbSNP:200700326
2681+a, gdbSNP:199610116
2701+c, tdbSNP:368857426
2703+a, gdbSNP:201419877
2715+c, tdbSNP:142700458
2723+g, tdbSNP:199815424
2732+a, gdbSNP:281865044
2733+a, gdbSNP:201505363
2736+g, tdbSNP:200280257
2773+a, cdbSNP:372233140
2794+c, tdbSNP:201622949
2818+dbSNP:
2818+a, cdbSNP:148113070
2835+a, tdbSNP:140851697
2868+g, tdbSNP:202244316
2879+a, gdbSNP:201184634
2882+a, gdbSNP:145926545
2890+c, gdbSNP:58559150
2892+a, gdbSNP:200795874
2895+a, gdbSNP:201810995
2908+a, gdbSNP:72547970
2910+a, gdbSNP:281865045
2929+a, gdbSNP:372775960
2951+dbSNP:
2951+g, tdbSNP:17519916
2952+a, tdbSNP:202241468
2964+a, gdbSNP:200442352
2965+, adbSNP:35344809
2965+a, gdbSNP:201165146
2978+c, tdbSNP:7966550
2985+c, tdbSNP:189460764
2994+c, tdbSNP:373486170
3001+dbSNP:
3001+g, tdbSNP:199847386
3004+a, c, gdbSNP:199606289
3027+a, gdbSNP:200577947
3036+a, gdbSNP:201718451
3039+a, gdbSNP:75148313
3041+a, gdbSNP:374617843
3051+c, tdbSNP:200171409
3060+a, gdbSNP:113160317
3061+g, tdbSNP:201042000
3085+a, c, gdbSNP:201980459
3121+a, cdbSNP:200063668
3134+c, tdbSNP:369516239
3139+a, gdbSNP:113217062
3140+a, gdbSNP:201571302
3142+c, tdbSNP:55783828
3146+c, gdbSNP:373366713
3147+a, cdbSNP:375146075
3148+g, tdbSNP:368989621
3149+c, tdbSNP:199635806
3154+a, gdbSNP:141252946
3172+c, gdbSNP:200969116
3193+a, gdbSNP:201407012
3196+c, gdbSNP:199585333
3212+c, tdbSNP:201552816
3218+dbSNP:
3218+a, gdbSNP:201698022
3236+c, tdbSNP:368296922
3279+a, cdbSNP:200055702
3292+c, gdbSNP:200663116
3305+a, cdbSNP:201935017
3320+a, cdbSNP:146948714
3321+a, gdbSNP:111341148
3381+a, gdbSNP:200705669
3383+a, tdbSNP:201591572
3386+a, cdbSNP:201707750
3394+a, gdbSNP:201784105
3408+c, gdbSNP:76535406
3412+a, tdbSNP:199860569
3434+a, gdbSNP:200513005
3439+a, gdbSNP:200006742
3451+a, gdbSNP:201305629
3454+g, tdbSNP:78365431
3463+a, gdbSNP:35808389
3481+dbSNP:
3481+a, gdbSNP:201613796
3485+a, gdbSNP:34805604
3526+c, tdbSNP:200441201
3550+c, tdbSNP:142989436
3552+a, tdbSNP:200204158
3553+a, gdbSNP:201121016
3571+a, gdbSNP:201511088
3572+a, gdbSNP:74985840
3581+a, gdbSNP:202169917
3590+a, tdbSNP:200364467
3598+g, tdbSNP:200965490
3615+c, tdbSNP:281865046
3616+c, tdbSNP:140114815
3638+c, tdbSNP:267603455
3648+a, cdbSNP:201522730
3679+c, tdbSNP:202138031
3695+a, gdbSNP:281865047
3732+dbSNP:
3732+a, gdbSNP:199884759
3743+a, gdbSNP:376070508
3757+a, gdbSNP:200643098
3763+c, tdbSNP:201856307
3764+a, gdbSNP:143710836
3768+a, gdbSNP:72546324
3769+c, gdbSNP:370495896
3776+c, tdbSNP:200572639
3793+a, gdbSNP:201547404
3800+c, tdbSNP:150840449
3804+c, g, tdbSNP:60185966
3814+g, tdbSNP:200221850
3826+g, tdbSNP:200883475
3843+c, tdbSNP:56095201
3860+c, gdbSNP:201694762
3902+dbSNP:
3902+c, tdbSNP:202227573
3905+c, gdbSNP:4640000
3913+c, tdbSNP:201197679
3918+c, gdbSNP:202074062
3929+c, tdbSNP:201775131
3934+a, gdbSNP:145128677
3938+c, gdbSNP:142252962
3953+, adbSNP:144040091
3962+c, tdbSNP:199497505
3988+a, gdbSNP:200798306
4007+g, tdbSNP:56320539
4008+a, tdbSNP:374991346
4015+c, tdbSNP:150001461
4027+c, gdbSNP:144488089
4039+g, tdbSNP:199812220
4060+a, tdbSNP:183902574
4081+dbSNP:
4081+c, g, tdbSNP:77018758
4089+a, gdbSNP:186669665
4090+a, gdbSNP:372245035
4095+a, gdbSNP:72546338
4099+a, gdbSNP:201636831
4114+g, tdbSNP:141293633
4121+c, tdbSNP:201177073
4137+c, tdbSNP:201640287
4151+a, gdbSNP:199831201
4153+a, gdbSNP:200253908
4173+g, tdbSNP:146958951
4178+a, cdbSNP:200526782
4215+a, gdbSNP:201768941
4232+a, gdbSNP:17466213
4246+a, cdbSNP:28365226
4255+c, tdbSNP:369661571
4277+a, cdbSNP:373130570
4283+a, cdbSNP:201453370
4286+a, gdbSNP:140743795
4288+c, tdbSNP:201036256
4307+g, tdbSNP:200791042
4313+dbSNP:
4313+c, tdbSNP:373268136
4314+a, gdbSNP:7133914
4315+g, tdbSNP:112676052
4321+a, gdbSNP:201587002
4331+a, tdbSNP:199579191
4342+c, tdbSNP:376175718
4350+c, tdbSNP:72546327
4351+a, gdbSNP:201407298
4354+a, gdbSNP:202113476
4366+c, tdbSNP:200014848
4377+a, gdbSNP:201013695
4379+a, gdbSNP:113589830
4390+a, gdbSNP:11175964
4405+a, tdbSNP:146142384
4411+c, tdbSNP:111435410
4430+a, cdbSNP:74163686
4441+dbSNP:
4441+c, tdbSNP:267603456
4442+c, g, tdbSNP:33939927
4443+a, gdbSNP:34995376
4444+c, tdbSNP:112998035
4445+c, gdbSNP:281865048
4453+c, tdbSNP:200108182
4457+a, cdbSNP:200660418
4458+c, tdbSNP:74681492
4468+c, tdbSNP:61915566
4469+a, gdbSNP:111501952
4471+c, tdbSNP:201906362
4477+a, gdbSNP:199618134
4485..4486+, atdbSNP:281865049
4496+a, gdbSNP:200197882
4506+g, tdbSNP:142095251
4507..4508+, adbSNP:35363614
4522+c, tdbSNP:370239119
4523+a, gdbSNP:281865050
4568+c, tdbSNP:114908017
4569+a, gdbSNP:113431708
4574+g, tdbSNP:199626271
4589+a, gdbSNP:201154630
4592+a, gdbSNP:202164649
4594+c, tdbSNP:144754773
4631+a, cdbSNP:193054490
4639+c, tdbSNP:202109311
4662+dbSNP:
4662+a, gdbSNP:35507033
4691+a, cdbSNP:201516457
4692+c, tdbSNP:202136451
4699+c, tdbSNP:200310612
4721+a, gdbSNP:141855590
4728+c, tdbSNP:201247412
4729+a, gdbSNP:202073944
4733+c, tdbSNP:150620977
4734+a, g, tdbSNP:200631999
4735+c, tdbSNP:201846112
4736+a, gdbSNP:199777744
4745+c, tdbSNP:33958906
4748+a, gdbSNP:201540075
4759+c, tdbSNP:144529349
4770+g, tdbSNP:200212150
4787+a, cdbSNP:17491187
4816+c, tdbSNP:113349411
4833+a, cdbSNP:147838722
4843+c, tdbSNP:139714137
4848+c, tdbSNP:201182268
4863+dbSNP:
4863+g, tdbSNP:372228016
4884+c, gdbSNP:201453887
4914+a, tdbSNP:721710
4925+g, tdbSNP:199555599
4936+a, gdbSNP:200304604
4946+a, cdbSNP:200841263
4955+dbSNP:
4955+a, gdbSNP:149927951
4959+c, tdbSNP:281865051
4967+a, gdbSNP:201790906
4996+g, tdbSNP:200418079
5001+c, tdbSNP:201637880
5004+a, c, gdbSNP:33949390
5015+c, gdbSNP:200580973
5022+c, tdbSNP:201283175
5031..5032+, gdbSNP:113611544
5032+a, gdbSNP:11176013
5033+a, cdbSNP:201620277
5047+a, gdbSNP:200242657
5058..5059+c, tdbSNP:34591826
5058+c, tdbSNP:35303786
5060+a, tdbSNP:11564148
5064+a, gdbSNP:200143418
5080+a, gdbSNP:111503579
5109+c, gdbSNP:201034266
5110+a, gdbSNP:201607756
5117+c, tdbSNP:199999378
5125+g, tdbSNP:201698837
5159+dbSNP:
5159+a, tdbSNP:200363745
5172+a, gdbSNP:201400897
5178+a, gdbSNP:202110497
5217+a, gdbSNP:35801418
5225+a, gdbSNP:201343106
5226+c, tdbSNP:200008981
5235+a, gdbSNP:370503302
5241+a, gdbSNP:200769426
5250+a, gdbSNP:139014427
5268+c, gdbSNP:142181172
5275+c, tdbSNP:150450334
5284+a, c, gdbSNP:79909111
5287+a, gdbSNP:200905003
5294+dbSNP:
5294+a, c, tdbSNP:11564176
5295+a, gdbSNP:72547979
5299+a, gdbSNP:200185983
5303+a, cdbSNP:201292708
5304+a, g, tdbSNP:145364431
5338+c, tdbSNP:200107211
5344+c, tdbSNP:201768478
5368+g, tdbSNP:374750575
5377+a, tdbSNP:199579318
5391+a, gdbSNP:368762897
5396+c, tdbSNP:370805423
5429+c, tdbSNP:138386040
5434+a, gdbSNP:372096498
5456+dbSNP:
5456+c, gdbSNP:370053016
5483+a, gdbSNP:373340746
5484+c, tdbSNP:376533552
5500+c, tdbSNP:200278957
5506+a, g, tdbSNP:111910483
5533+a, gdbSNP:200951081
5538+c, tdbSNP:201930496
5555+g, tdbSNP:199966130
5556+c, tdbSNP:149592978
5568+a, tdbSNP:201505049
5572+c, tdbSNP:200924532
5578+c, tdbSNP:10878371
5588+a, cdbSNP:72547980
5605+c, tdbSNP:199668099
5616+a, cdbSNP:200214291
5630+a, gdbSNP:201459392
5635+dbSNP:
5635+c, tdbSNP:200326242
5638+a, cdbSNP:372427005
5656+a, gdbSNP:199888180
5661+a, gdbSNP:142998392
5662+a, gdbSNP:370951456
5675+a, gdbSNP:147442556
5686+c, tdbSNP:144737848
5710+c, tdbSNP:200612782
5726+a, gdbSNP:281865052
5727+c, tdbSNP:35602796
5731+g, tdbSNP:281865053
5736+a, gdbSNP:199553529
5741+g, tdbSNP:281865054
5744+c, tdbSNP:200433646
5771+c, tdbSNP:71653641
5804+dbSNP:
5804+c, tdbSNP:199762345
5812+c, gdbSNP:200436043
5820+a, gdbSNP:201752951
5835+g, tdbSNP:201807960
5847+a, gdbSNP:200182753
5866+a, gdbSNP:369673265
5869+a, gdbSNP:201169885
5905+dbSNP:
5905+c, tdbSNP:199697361
5920+a, tdbSNP:139746572
5943+a, gdbSNP:77428810
5978+c, gdbSNP:201968874
5990+c, tdbSNP:200521995
5991+a, g, tdbSNP:201012950
6004+a, gdbSNP:202180320
6017+c, tdbSNP:375022337
6029+c, tdbSNP:369497805
6052+c, tdbSNP:201119482
6054+c, tdbSNP:201689433
6098+dbSNP:
6098+c, tdbSNP:199993519
6127+c, tdbSNP:368274118
6134+c, tdbSNP:370747129
6137+c, tdbSNP:281865055
6144+a, gdbSNP:200453044
6156+c, tdbSNP:34015634
6175+c, tdbSNP:150219613
6176+a, gdbSNP:34637584
6180+c, tdbSNP:35870237
6187+a, gdbSNP:183394865
6192+g, tdbSNP:367818872
6212+a, tdbSNP:78029637
6229+a, gdbSNP:200434075
6236+dbSNP:
6236+c, tdbSNP:200765656
6241+a, cdbSNP:201500816
6242+c, tdbSNP:199926124
6295+a, gdbSNP:112878083
6308..6312+, ctctadbSNP:111739194
6310+c, gdbSNP:376549558
6331+a, c, tdbSNP:149694980
6333+a, gdbSNP:199672415
6341+a, gdbSNP:200498558
6342+c, tdbSNP:201456484
6352+a, gdbSNP:200043517
6362+a, gdbSNP:33995883
6363+a, tdbSNP:200754183
6376+a, gdbSNP:373378281
6410+dbSNP:
6410+a, gdbSNP:201758786
6427+c, tdbSNP:199567707
6445+a, gdbSNP:10878405
6458+c, gdbSNP:201513336
6477+c, tdbSNP:12423862
6505+dbSNP:
6505+c, gdbSNP:145225800
6535+c, gdbSNP:201942181
6536+a, tdbSNP:112048985
6543+c, tdbSNP:111691891
6544+a, gdbSNP:369306296
6546+a, gdbSNP:371284884
6548+c, tdbSNP:200827521
6549+a, gdbSNP:201271001
6568+c, tdbSNP:199733811
6573+a, tdbSNP:200206597
6582+c, gdbSNP:371316474
6584+a, gdbSNP:201614703
6618+a, c, gdbSNP:201503829
6631+a, cdbSNP:34869625
6643+c, tdbSNP:149013010
6644+a, c, gdbSNP:72547981
6651+c, gdbSNP:201215607
6684+c, gdbSNP:202072135
6687+a, gdbSNP:35658131
6800+dbSNP:
6800+a, gdbSNP:199545534
6802+c, gdbSNP:370765940
6803+a, gdbSNP:200430264
6809+a, gdbSNP:201317931
6835+a, tdbSNP:202244108
6836+a, gdbSNP:200682120
6855+c, tdbSNP:376428096
6873+a, c, gdbSNP:200419481
6885+a, tdbSNP:200762374
6892+dbSNP:
6892+a, cdbSNP:200300610
6900+a, cdbSNP:201427099
6903+a, tdbSNP:12581902
6921+c, gdbSNP:374444402
6922+c, tdbSNP:148143226
6931+a, cdbSNP:200248746
6950+g, tdbSNP:200936547
6957+a, cdbSNP:201683993
6997+dbSNP:
6997+c, tdbSNP:201011415
7023+c, tdbSNP:202177571
7033+a, tdbSNP:150232231
7049+a, gdbSNP:202179802
7050+c, tdbSNP:200002022
7089+g, tdbSNP:200690628
7102+c, tdbSNP:143032867
7105+g, tdbSNP:202003642
7144+a, cdbSNP:147450948
7151+dbSNP:
7151+g, tdbSNP:188212126
7157+c, tdbSNP:138264225
complement(7158)-g, adbSNP:75695264
7160+a, gdbSNP:201264752
7187..7188+, gtdbSNP:111272009
7188+c, tdbSNP:113511708
7190+a, gdbSNP:199794995
7192+g, tdbSNP:200701193
7210+c, tdbSNP:201329694
7213+c, tdbSNP:199694626
7238+a, gdbSNP:200241554
7274+a, gdbSNP:34778348
7276+a, gdbSNP:33962975
7289+a, gdbSNP:79546190
7290+a, tdbSNP:376230626
7294+c, gdbSNP:199680004
7301+a, cdbSNP:146225678
7303+dbSNP:
7303+c, gdbSNP:200495404
7304+a, gdbSNP:78964014
7307+a, gdbSNP:201139905
7308..7309+, gtdbSNP:281865056
7326..7327+, gdbSNP:35316157
7330+a, cdbSNP:199545224
7345+a, gdbSNP:60545352
7375+a, cdbSNP:369151534
7384+c, gdbSNP:200811557
7409+a, gdbSNP:201913693
7417+c, g, tdbSNP:199964631
7421+a, gdbSNP:398124661
7436+a, cdbSNP:72547983
7441+a, gdbSNP:144027504
7445+c, tdbSNP:199893519
7455+c, tdbSNP:186665868
7458+a, gdbSNP:200795955
7482+a, c, tdbSNP:201502655
7483+a, gdbSNP:199832934
7486+c, gdbSNP:200275290
7503+c, tdbSNP:201037550
7518+dbSNP:
7518+a, tdbSNP:281865057
7550+c, tdbSNP:138780308
7551+a, gdbSNP:146428335
7556+a, gdbSNP:55633591
7558+c, tdbSNP:202033317
7589+dbSNP:
7589+, cdbSNP:281865058
7603+c, tdbSNP:140665554
7604+a, gdbSNP:150062967
7613+a, gdbSNP:112895037
7618+g, tdbSNP:201555723
7625+a, cdbSNP:199536554
7633+a, gdbSNP:200513673
7634+, cdbSNP:201147695
7648+a, gdbSNP:377279702
7653+c, tdbSNP:201312806
7689+a, gdbSNP:202179421
7694+c, tdbSNP:200418197
7751+c, tdbSNP:201079798
7755+c, tdbSNP:201564290
7768+a, tdbSNP:199923074
7780+c, gdbSNP:74422210
7788+a, gdbSNP:200854679
7789+a, gdbSNP:201671072
7796+a, gdbSNP:199839016
7801+c, tdbSNP:66737902
7815+a, gdbSNP:139288753
7828+a, cdbSNP:73277568
7853+a, c, tdbSNP:202205832
7864+a, gdbSNP:200229279
7878+a, gdbSNP:200922568
complement(7890)-t, cdbSNP:2553848
7903+c, tdbSNP:180825086
7907+a, gdbSNP:202004818
7934+a, gdbSNP:200343036
7952+a, tdbSNP:200119450
7953+a, tdbSNP:200639089
7958+a, gdbSNP:201905091
7987+c, tdbSNP:199690769
7990+a, cdbSNP:17444251
7994+c, tdbSNP:17444258
8009+c, tdbSNP:200752897
8010+a, gdbSNP:201674027
8039+a, gdbSNP:201763689
8051+a, gdbSNP:17520676
8069+a, cdbSNP:10878441
8089+c, tdbSNP:3886747
8108+c, tdbSNP:200001932
8110+a, c, tdbSNP:200503610
8124+a, tdbSNP:202030334
8170+a, gdbSNP:199535249
8175+g, tdbSNP:200678400
8176+a, cdbSNP:201077057
8199+a, gdbSNP:185229689
8224+c, gdbSNP:199791467
8225+g, tdbSNP:200379131
8227+c, tdbSNP:200868740
8248+c, tdbSNP:373184816
8258+c, gdbSNP:202085870
8270+a, gdbSNP:199912390
8312+a, gdbSNP:201345100
8320+a, tdbSNP:201422404
8340+a, cdbSNP:140933065
8345+a, gdbSNP:199877553
8428+g, tdbSNP:200689230
8441+c, gdbSNP:1365770
8456+a, cdbSNP:199692050
8467+c, gdbSNP:200232206
8474+g, tdbSNP:201106361
8485+a, c, tdbSNP:144867720
8491+c, tdbSNP:200128584
8557+c, tdbSNP:190574068
8564+a, gdbSNP:200880332
8578+c, tdbSNP:17491821
8612+a, cdbSNP:201600596
8615+c, tdbSNP:199663160
8623+c, tdbSNP:200592339
8630+c, tdbSNP:201440501
8631..8632+, tttdbSNP:368945279
8631+c, tdbSNP:199620259
8631+, tdbSNP:367772598
8639..8640+, tttdbSNP:386376255
8641..8642+, t, tttdbSNP:10627876
8641+c, tdbSNP:200546919
8642+c, tdbSNP:201562091
8647+c, tdbSNP:182229935
8649+a, gdbSNP:201256649
8653+a, gdbSNP:201907480
8675+a, cdbSNP:200052290
8676+a, cdbSNP:200935645
8684+c, tdbSNP:10784548
8691+c, tdbSNP:199880363
8723+g, tdbSNP:200782338
8740+c, tdbSNP:201488873
8774+a, gdbSNP:199823070
8787+a, gdbSNP:200274166
8792+c, gdbSNP:201047687
8797+c, tdbSNP:202059842
8810+a, gdbSNP:201215436
8827+a, gdbSNP:202238215
8847+c, tdbSNP:199984063
8863+g, tdbSNP:186859188
8870+a, c, tdbSNP:200135922
8871+a, gdbSNP:201819175
8879+a, cdbSNP:201839691
8884+a, gdbSNP:199722626
complement(8886)-t, cdbSNP:147956597
8887+c, tdbSNP:376228552
8918+c, tdbSNP:200612089
8926+a, gdbSNP:149014742
8935+a, gdbSNP:201488180
8942+c, tdbSNP:202007818
9028+g, tdbSNP:200402166
9055+g, tdbSNP:199780825
9084+a, tdbSNP:201000767
9088+a, gdbSNP:191653874
9091+c, tdbSNP:200066955
9093+c, tdbSNP:200410756
9107+g, tdbSNP:201559861
9111..9112+, cdbSNP:146167013
9128+a, tdbSNP:199603996
9133+a, gdbSNP:200509191
9134+c, gdbSNP:142051987
9144+a, gdbSNP:201380384
9151+a, tdbSNP:12422278
9169+g, tdbSNP:17491828
9175+a, cdbSNP:199493661
9187+a, gdbSNP:17491835
9187+a, gdbSNP:199493660
9196+a, gdbSNP:140162879
9199+a, tdbSNP:199493659
9213+a, tdbSNP:199493658
Gene SymbolLRRK2
Gene SynonymAURA17; DARDARIN; PARK8; RIPK7; ROCO2
Chromosome12
Locus Map12q12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_198578 Homo sapiens leucine-rich repeat kinase 2 (LRRK2), mRNA. On-demand $3749.00 35
XM_005268629 PREDICTED: Homo sapiens leucine-rich repeat kinase 2 (LRRK2), transcript variant X1, mRNA. On-demand $3749.00 35
Title Characterization of NAADP-mediated calcium signaling in human spermatozoa .
Author Sanchez-Tusie AA, Vasudevan SR, Churchill GC, Nishigaki T and Trevino CL.
Journal Biochem. Biophys. Res. Commun. 443 (2), 531-536 (2014)
Title A direct interaction between leucine-rich repeat kinase 2 and specific beta-tubulin isoforms regulates tubulin acetylation .
Author Law BM, Spain VA, Leinster VH, Chia R, Beilina A, Cho HJ, Taymans JM, Urban MK, Sancho RM, Ramirez MB, Biskup S, Baekelandt V, Cai H, Cookson MR, Berwick DC and Harvey K.
Journal J. Biol. Chem. 289 (2), 895-908 (2014)
Title Mutant LRRK2 toxicity in neurons depends on LRRK2 levels and synuclein but not kinase activity or inclusion bodies .
Author Skibinski G, Nakamura K, Cookson MR and Finkbeiner S.
Journal J. Neurosci. 34 (2), 418-433 (2014)
Title Parkinson-related LRRK2 mutation R1441C/G/H impairs PKA phosphorylation of LRRK2 and disrupts its interaction with 14-3-3 .
Author Muda K, Bertinetti D, Gesellchen F, Hermann JS, von Zweydorf F, Geerlof A, Jacob A, Ueffing M, Gloeckner CJ and Herberg FW.
Journal Proc. Natl. Acad. Sci. U.S.A. 111 (1), E34-E43 (2014)
Title Cloning of the gene containing mutations that cause PARK8-linked Parkinson's disease .
Author Paisan-Ruiz C, Jain S, Evans EW, Gilks WP, Simon J, van der Brug M, Lopez de Munain A, Aparicio S, Gil AM, Khan N, Johnson J, Martinez JR, Nicholl D, Carrera IM, Pena AS, de Silva R, Lees A, Marti-Masso JF, Perez-Tur J, Wood NW and Singleton AB.
Journal Neuron 44 (4), 595-600 (2004)
Title The PARK8 locus in autosomal dominant parkinsonism: confirmation of linkage and further delineation of the disease-containing interval .
Author Zimprich A, Muller-Myhsok B, Farrer M, Leitner P, Sharma M, Hulihan M, Lockhart P, Strongosky A, Kachergus J, Calne DB, Stoessl J, Uitti RJ, Pfeiffer RF, Trenkwalder C, Homann N, Ott E, Wenzel K, Asmus F, Hardy J, Wszolek Z and Gasser T.
Journal Am. J. Hum. Genet. 74 (1), 11-19 (2004)
Title Identifying novel transcripts and novel genes in the human genome by using novel SAGE tags .
Author Chen J, Sun M, Lee S, Zhou G, Rowley JD and Wang SM.
Journal Proc. Natl. Acad. Sci. U.S.A. 99 (19), 12257-12262 (2002)
Title A new locus for Parkinson's disease (PARK8) maps to chromosome 12p11.2-q13.1 .
Author Funayama M, Hasegawa K, Kowa H, Saito M, Tsuji S and Obata F.
Journal Ann. Neurol. 51 (3), 296-301 (2002)
Title Parkinson Disease Overview .
Author Farlow,J., Pankratz,N.D., Wojcieszek,J. and Foroud,T.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title LRRK2-Related Parkinson Disease .
Author Farrer,M. and Ross,O.A.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.