• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens surfactant protein B (SFTPB), transcript variant 2, mRNA.


RefSeq Accession Definition Services Price Order
NM_198843 Homo sapiens surfactant protein B (SFTPB), transcript variant 2, mRNA. ORF Sequence $342.78
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_198843.2, 288856296
Length 2854 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens surfactant protein B (SFTPB), transcript variant 2, mRNA.
Product pulmonary surfactant-associated protein B precursor
Comment

Summary: This gene encodes the pulmonary-associated surfactant protein B (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% proteins which include plasma proteins and apolipoproteins SPA, SPB, SPC and SPD. The surfactant is secreted by the alveolar cells of the lung and maintains the stability of pulmonary tissue by reducing the surface tension of fluids that coat the lung. The SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Multiple mutations in this gene have been identified, which cause pulmonary surfactant metabolism dysfunction type 1, also called pulmonary alveolar proteinosis due to surfactant protein B deficiency, and are associated with fatal respiratory distress in the neonatal period. Alternatively spliced transcript variants encoding the same protein have been identified.[provided by RefSeq, Feb 2010].


Transcript Variant: This variant (2) lacks an internal segment in the 3' UTR, as compared to variant 1. Both variants 1 and 2 encode the same protein.

RefSeq NP_942140.2
CDS 101..1282
Misc Feature(1)92..94
Misc Feature(2)218..319
Misc Feature(3)332..448
Misc Feature(4)335..565
Misc Feature(5)464..565
Misc Feature(6)752..967
Misc Feature(7)1025..1234
Misc Feature(8)1130..1234
Exon (1)1..68
Gene:SFTPB
Gene Synonym:PSP-B; SFTB3; SFTP3; SMDP1; SP-B
Exon (2)69..203
Gene:SFTPB
Gene Synonym:PSP-B; SFTB3; SFTP3; SMDP1; SP-B
Exon (3)204..331
Gene:SFTPB
Gene Synonym:PSP-B; SFTB3; SFTP3; SMDP1; SP-B
Exon (4)332..403
Gene:SFTPB
Gene Synonym:PSP-B; SFTB3; SFTP3; SMDP1; SP-B
Exon (5)404..529
Gene:SFTPB
Gene Synonym:PSP-B; SFTB3; SFTP3; SMDP1; SP-B
Exon (6)530..718
Gene:SFTPB
Gene Synonym:PSP-B; SFTB3; SFTP3; SMDP1; SP-B
Exon (7)719..808
Gene:SFTPB
Gene Synonym:PSP-B; SFTB3; SFTP3; SMDP1; SP-B
Exon (8)809..992
Gene:SFTPB
Gene Synonym:PSP-B; SFTB3; SFTP3; SMDP1; SP-B
Exon (9)993..1138
Gene:SFTPB
Gene Synonym:PSP-B; SFTB3; SFTP3; SMDP1; SP-B
Exon (10)1139..1219
Gene:SFTPB
Gene Synonym:PSP-B; SFTB3; SFTP3; SMDP1; SP-B
Exon (11)1220..1301
Gene:SFTPB
Gene Synonym:PSP-B; SFTB3; SFTP3; SMDP1; SP-B
Exon (12)1302..2840
Gene:SFTPB
Gene Synonym:PSP-B; SFTB3; SFTP3; SMDP1; SP-B
Translation MHQAGYPGCRGAMAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQ CRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLL MPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPL PDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALA VAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSP TGEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLT LVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(83)-dbSNP:
complement(83)-g, adbSNP:34024265
complement(95)-g, adbSNP:3024792
complement(99)-t, cdbSNP:35531973
complement(105)-c, adbSNP:2077079
complement(106)-t, cdbSNP:35509268
complement(177..179)-, gcadbSNP:147057701
complement(184)-g, adbSNP:3024793
complement(326)-dbSNP:
complement(326)-t, cdbSNP:148914290
complement(361)-dbSNP:
complement(361)-g, adbSNP:145895555
complement(408)-dbSNP:
complement(408)-t, cdbSNP:45488101
complement(409)-g, adbSNP:45478492
complement(427)-g, adbSNP:34682912
complement(433)-g, cdbSNP:189048961
complement(439)-t, gdbSNP:148450039
complement(487)-g, adbSNP:147417469
complement(488)-g, adbSNP:45557339
complement(494)-g, adbSNP:138729391
complement(497)-g, cdbSNP:141905538
complement(497)-c, gaadbSNP:35328240
complement(509)-t, cdbSNP:140667432
complement(512)-c, adbSNP:184305471
complement(528)-t, cdbSNP:1130866
complement(539)-dbSNP:
complement(539)-g, adbSNP:35373464
complement(646)-t, gdbSNP:149904344
complement(662)-t, cdbSNP:3024801
complement(664)-g, adbSNP:147209702
complement(665)-g, adbSNP:34550459
complement(680)-g, adbSNP:138274558
complement(682)-t, cdbSNP:45505791
complement(683)-t, cdbSNP:184494733
complement(684)-g, adbSNP:35524245
complement(706)-g, cdbSNP:141123597
complement(712)-t, cdbSNP:45601634
complement(727)-dbSNP:
complement(727)-t, cdbSNP:45530632
complement(739)-t, gdbSNP:190610109
complement(743)-t, cdbSNP:149956217
complement(747)-g, adbSNP:150799880
complement(769)-t, cdbSNP:35049407
complement(810)-dbSNP:
complement(810)-, cdbSNP:34267160
complement(818)-g, cdbSNP:2854728
complement(819)-g, cdbSNP:2854729
complement(830..831)-, cdbSNP:145611216
complement(842)-t, cdbSNP:137853202
complement(862)-t, cdbSNP:144359413
complement(899)-t, cdbSNP:186576601
complement(918)-c, adbSNP:150488697
complement(922)-g, cdbSNP:138686998
complement(926)-t, cdbSNP:45595337
complement(951)-g, adbSNP:3024809
complement(963)-t, cdbSNP:201996765
complement(979)-t, cdbSNP:3024810
complement(981)-t, gdbSNP:45551431
complement(983)-g, adbSNP:36210375
complement(999)-dbSNP:
complement(999)-t, cdbSNP:35076740
complement(1005)-g, adbSNP:45504597
complement(1064)-t, cdbSNP:201986026
complement(1146)-dbSNP:
complement(1146)-t, adbSNP:143687195
complement(1165)-g, adbSNP:45606043
complement(1272)-dbSNP:
complement(1272)-g, cdbSNP:144831319
complement(1294)-c, adbSNP:45529633
complement(1312)-dbSNP:
complement(1312)-t, cdbSNP:3024828
complement(1644)-t, gdbSNP:114238614
complement(1802)-g, adbSNP:182172598
complement(1818)-t, cdbSNP:191054350
complement(1981)-g, adbSNP:56204952
complement(2095)-t, adbSNP:186308421
complement(2150)-g, adbSNP:113189011
complement(2190)-g, adbSNP:138799416
complement(2226)-g, adbSNP:1065188
complement(2233)-g, adbSNP:1065189
complement(2237)-t, gdbSNP:1058850
complement(2247)-g, adbSNP:10625
complement(2276)-g, adbSNP:1065192
complement(2302)-g, adbSNP:115696450
complement(2303)-g, adbSNP:3024829
complement(2367)-t, cdbSNP:113824447
complement(2554)-t, cdbSNP:201660047
complement(2597)-t, cdbSNP:200871431
complement(2636)-g, adbSNP:3024830
complement(2803)-t, adbSNP:56192916
Gene SymbolSFTPB
Gene SynonymPSP-B; SFTB3; SFTP3; SMDP1; SP-B
Chromosome2
Locus Map2p12-p11.2
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000542 Homo sapiens surfactant protein B (SFTPB), transcript variant 1, mRNA. Full Length $1288.35
ORF Sequence $342.78
NM_198843 Homo sapiens surfactant protein B (SFTPB), transcript variant 2, mRNA. Full Length $827.66
ORF Sequence $342.78
Title [Relationship between pulmonary surfactant-associated protein B polymorphisms and the susceptibility to neonatal respiratory distress syndrome] .
Author Lu,W.C., Xiang,W., Wu,M., Zheng,X., Lin,J., Chen,X.Y., Wei,H.B., Zhan,D. and Li,C.L.
Journal Zhongguo Dang Dai Er Ke Za Zhi 14 (1), 24-27 (2012)
Title Genetic variant associations of human SP-A and SP-D with acute and chronic lung injury .
Author Silveyra,P. and Floros,J.
Journal Front. Biosci. 17, 407-429 (2012)
Title Kinetics of plasma SPB and RAGE during mechanical ventilation in patients undergoing major vascular surgery .
Author Agostoni,P., Banfi,C., Magri,D., Vignati,C., Doria,E., Salvioni,E., Moliterni,P., Marenzi,G., Tremoli,E. and Sisillo,E.
Journal Respir Physiol Neurobiol 178 (2), 256-260 (2011)
Title Interactions between smoking, pulmonary surfactant protein B, and atherosclerosis in the general population: the Dallas Heart Study .
Author Nguyen,A.B., Rohatgi,A., Garcia,C.K., Ayers,C.R., Das,S.R., Lakoski,S.G., Berry,J.D., Khera,A., McGuire,D.K. and de Lemos,J.A.
Journal Arterioscler. Thromb. Vasc. Biol. 31 (9), 2136-2143 (2011)
Title Amniotic fluid concentration of surfactant proteins in intra-amniotic infection .
Author Chaiworapongsa,T., Hong,J.S., Hull,W.M., Romero,R. and Whitsett,J.A.
Journal J. Matern. Fetal. Neonatal. Med. 21 (9), 663-670 (2008)
Title Surfactant protein B detection and gene expression in chronic rhinosinusitis .
Author Woodworth,B.A., Wood,R., Bhargave,G., Cohen,N.A., Baatz,J.E. and Schlosser,R.J.
Journal Laryngoscope 117 (7), 1296-1301 (2007)
Title Intracellular processing of pulmonary surfactant protein B in an endosomal/lysosomal compartment .
Author Voorhout,W.F., Veenendaal,T., Haagsman,H.P., Weaver,T.E., Whitsett,J.A., van Golde,L.M. and Geuze,H.J.
Journal Am. J. Physiol. 263 (4 PT 1), L479-L486 (1992)
Title Effect of pulmonary surfactant protein B (SP-B) and calcium on phospholipid adsorption and squeeze-out of phosphatidylglycerol from binary phospholipid monolayers containing dipalmitoylphosphatidylcholine .
Author Yu,S.H. and Possmayer,F.
Journal Biochim. Biophys. Acta 1126 (1), 26-34 (1992)
Title Human surfactant polypeptide SP-B. Disulfide bridges, C-terminal end, and peptide analysis of the airway form .
Author Johansson,J., Jornvall,H. and Curstedt,T.
Journal FEBS Lett. 301 (2), 165-167 (1992)
Title Chromosomal localization of three pulmonary surfactant protein genes in the mouse .
Author Moore,K.J., D'Amore-Bruno,M.A., Korfhagen,T.R., Glasser,S.W., Whitsett,J.A., Jenkins,N.A. and Copeland,N.G.
Journal Genomics 12 (2), 388-393 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878