• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens surfactant protein B (SFTPB), transcript variant 2, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu09313 Homo sapiens surfactant protein B (SFTPB), transcript variant 2, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu09313C Homo sapiens surfactant protein B (SFTPB), transcript variant 2, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_198843.2, 288856296
Length 1182 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens surfactant protein B (SFTPB), transcript variant 2, mRNA.
Product pulmonary surfactant-associated protein B precursor
Comment

Summary: This gene encodes the pulmonary-associated surfactant protein B (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% proteins which include plasma proteins and apolipoproteins SPA, SPB, SPC and SPD. The surfactant is secreted by the alveolar cells of the lung and maintains the stability of pulmonary tissue by reducing the surface tension of fluids that coat the lung. The SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Multiple mutations in this gene have been identified, which cause pulmonary surfactant metabolism dysfunction type 1, also called pulmonary alveolar proteinosis due to surfactant protein B deficiency, and are associated with fatal respiratory distress in the neonatal period. Alternatively spliced transcript variants encoding the same protein have been identified.[provided by RefSeq, Feb 2010].


Transcript Variant: This variant (2) lacks an internal segment in the 3' UTR, as compared to variant 1. Both variants 1 and 2 encode the same protein.

RefSeq NP_942140.2
CDS 101..1282
Misc Feature(1)92..94
Misc Feature(2)218..319
Misc Feature(3)332..448
Misc Feature(4)335..565
Misc Feature(5)464..559
Misc Feature(6)752..967
Misc Feature(7)1025..1234
Misc Feature(8)1130..1228
Exon (1)1..68
Gene:SFTPB
Gene Synonym:PSP-B; SFTB3; SFTP3; SMDP1; SP-B
Exon (2)69..203
Gene:SFTPB
Gene Synonym:PSP-B; SFTB3; SFTP3; SMDP1; SP-B
Exon (3)204..331
Gene:SFTPB
Gene Synonym:PSP-B; SFTB3; SFTP3; SMDP1; SP-B
Exon (4)332..403
Gene:SFTPB
Gene Synonym:PSP-B; SFTB3; SFTP3; SMDP1; SP-B
Exon (5)404..529
Gene:SFTPB
Gene Synonym:PSP-B; SFTB3; SFTP3; SMDP1; SP-B
Exon (6)530..718
Gene:SFTPB
Gene Synonym:PSP-B; SFTB3; SFTP3; SMDP1; SP-B
Exon (7)719..808
Gene:SFTPB
Gene Synonym:PSP-B; SFTB3; SFTP3; SMDP1; SP-B
Exon (8)809..992
Gene:SFTPB
Gene Synonym:PSP-B; SFTB3; SFTP3; SMDP1; SP-B
Exon (9)993..1138
Gene:SFTPB
Gene Synonym:PSP-B; SFTB3; SFTP3; SMDP1; SP-B
Exon (10)1139..1219
Gene:SFTPB
Gene Synonym:PSP-B; SFTB3; SFTP3; SMDP1; SP-B
Exon (11)1220..1301
Gene:SFTPB
Gene Synonym:PSP-B; SFTB3; SFTP3; SMDP1; SP-B
Exon (12)1302..2840
Gene:SFTPB
Gene Synonym:PSP-B; SFTB3; SFTP3; SMDP1; SP-B
Translation MHQAGYPGCRGAMAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQ CRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLL MPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPL PDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALA VAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSP TGEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLT LVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
83+dbSNP:
83+a, gdbSNP:34024265
95+a, gdbSNP:3024792
complement(95)-g, adbSNP:386578692
99+c, tdbSNP:35531973
105+a, cdbSNP:2077079
106+c, tdbSNP:35509268
complement(177..179)-, gcadbSNP:147057701
complement(184)-g, adbSNP:3024793
complement(199)-g, cdbSNP:369145822
complement(268)-dbSNP:
complement(268)-t, cdbSNP:377675937
complement(326)-t, cdbSNP:148914290
complement(361)-dbSNP:
complement(361)-g, adbSNP:145895555
408+dbSNP:
408+c, tdbSNP:45488101
409+a, gdbSNP:45478492
427+a, gdbSNP:34682912
complement(433)-g, cdbSNP:189048961
complement(487)-g, adbSNP:147417469
488+a, gdbSNP:45557339
complement(493)-g, adbSNP:368293273
complement(494)-g, adbSNP:138729391
complement(497)-g, cdbSNP:141905538
497+c, gaadbSNP:35328240
complement(509)-t, cdbSNP:140667432
complement(512)-c, adbSNP:184305471
528+c, tdbSNP:1130866
complement(538)-dbSNP:
complement(538)-g, adbSNP:374131015
539+a, gdbSNP:35373464
complement(573)-t, cdbSNP:367831550
complement(615)-g, adbSNP:375203471
complement(629)-g, adbSNP:370715446
complement(630)-t, cdbSNP:370750455
complement(646)-t, gdbSNP:149904344
complement(652)-g, cdbSNP:377624872
complement(662)-t, cdbSNP:3024801
complement(662)-t, cdbSNP:386578693
complement(664)-g, adbSNP:147209702
665+a, gdbSNP:34550459
complement(680)-g, adbSNP:138274558
682+c, tdbSNP:45505791
complement(683)-t, cdbSNP:184494733
684+a, gdbSNP:35524245
complement(706)-g, cdbSNP:141123597
complement(708)-g, adbSNP:377545629
712+c, tdbSNP:45601634
complement(719)-dbSNP:
complement(719)-t, cdbSNP:267599489
727+c, tdbSNP:45530632
complement(739)-t, gdbSNP:190610109
complement(743)-t, cdbSNP:149956217
complement(747)-g, adbSNP:150799880
769+c, tdbSNP:35049407
complement(813)-dbSNP:
complement(813)-g, adbSNP:369801396
818..819+c, gdbSNP:2854728
complement(830..831)-, cdbSNP:145611216
842+c, tdbSNP:137853202
complement(844)-g, adbSNP:367661082
complement(862)-t, cdbSNP:144359413
complement(899)-t, cdbSNP:186576601
complement(922)-g, cdbSNP:138686998
926+c, tdbSNP:45595337
complement(927)-t, cdbSNP:371267944
complement(951)-g, adbSNP:3024809
complement(963)-t, cdbSNP:201996765
979+c, tdbSNP:3024810
981+g, tdbSNP:45551431
983+a, gdbSNP:36210375
999+dbSNP:
999+c, tdbSNP:35076740
1005+a, gdbSNP:45504597
complement(1064)-t, cdbSNP:201986026
complement(1146)-dbSNP:
complement(1146)-t, adbSNP:143687195
1165+a, gdbSNP:45606043
complement(1177)-g, cdbSNP:368681670
complement(1245)-dbSNP:
complement(1245)-g, adbSNP:374932425
complement(1249)-t, gdbSNP:370528656
complement(1251)-g, cdbSNP:368016212
complement(1272)-g, cdbSNP:144831319
complement(1274)-t, cdbSNP:370785493
complement(1294)-c, adbSNP:45529633
complement(1297)-g, adbSNP:371255380
1312+dbSNP:
1312+c, tdbSNP:3024828
complement(1644)-t, gdbSNP:114238614
complement(1696)-t, cdbSNP:375619953
complement(1802)-g, adbSNP:182172598
complement(1818)-t, cdbSNP:191054350
complement(1981)-g, adbSNP:56204952
complement(2095)-t, adbSNP:186308421
complement(2150)-g, adbSNP:113189011
complement(2190)-g, adbSNP:138799416
complement(2218..2219)-, attctdbSNP:374853987
complement(2247)-g, adbSNP:10625
2276+a, gdbSNP:1065192
complement(2302)-g, adbSNP:115696450
2303+a, gdbSNP:3024829
complement(2367)-t, cdbSNP:113824447
complement(2396)-g, adbSNP:371563274
complement(2554)-t, cdbSNP:201660047
complement(2597)-t, cdbSNP:200871431
complement(2636)-g, adbSNP:3024830
complement(2803)-t, adbSNP:56192916
Gene SymbolSFTPB
Gene SynonymPSP-B; SFTB3; SFTP3; SMDP1; SP-B
Chromosome2
Locus Map2p12-p11.2
Title Amplification of steroid-mediated SP-B expression by physiological levels of caffeine .
Author Fehrholz M, Hutten M, Kramer BW, Speer CP and Kunzmann S.
Journal Am. J. Physiol. Lung Cell Mol. Physiol. 306 (1), L101-L109 (2014)
Title LPS-treated macrophage cytokines repress surfactant protein-B in lung epithelial cells .
Author Bein K, Di Giuseppe M, Mischler SE, Ortiz LA and Leikauf GD.
Journal Am. J. Respir. Cell Mol. Biol. 49 (2), 306-315 (2013)
Title Detection of surfactant proteins A, B, C, and D in human nasal mucosa and their regulation in chronic rhinosinusitis with polyps .
Author Schicht M, Knipping S, Hirt R, Beileke S, Sel S, Paulsen F and Brauer L.
Journal Am J Rhinol Allergy 27 (1), 24-29 (2013)
Title Surfactant protein B deficiency and gene mutations for neonatal respiratory distress syndrome in China Han ethnic population .
Author Yin X, Meng F, Wang Y, Xie L, Kong X and Feng Z.
Journal Int J Clin Exp Pathol 6 (2), 267-272 (2013)
Title Amniotic fluid concentration of surfactant proteins in intra-amniotic infection .
Author Chaiworapongsa T, Hong JS, Hull WM, Romero R and Whitsett JA.
Journal J. Matern. Fetal. Neonatal. Med. 21 (9), 663-670 (2008)
Title Surfactant protein B detection and gene expression in chronic rhinosinusitis .
Author Woodworth BA, Wood R, Bhargave G, Cohen NA, Baatz JE and Schlosser RJ.
Journal Laryngoscope 117 (7), 1296-1301 (2007)
Title Intracellular processing of pulmonary surfactant protein B in an endosomal/lysosomal compartment .
Author Voorhout WF, Veenendaal T, Haagsman HP, Weaver TE, Whitsett JA, van Golde LM and Geuze HJ.
Journal Am. J. Physiol. 263 (4 PT 1), L479-L486 (1992)
Title Effect of pulmonary surfactant protein B (SP-B) and calcium on phospholipid adsorption and squeeze-out of phosphatidylglycerol from binary phospholipid monolayers containing dipalmitoylphosphatidylcholine .
Author Yu SH and Possmayer F.
Journal Biochim. Biophys. Acta 1126 (1), 26-34 (1992)
Title Human surfactant polypeptide SP-B. Disulfide bridges, C-terminal end, and peptide analysis of the airway form .
Author Johansson J, Jornvall H and Curstedt T.
Journal FEBS Lett. 301 (2), 165-167 (1992)
Title Chromosomal localization of three pulmonary surfactant protein genes in the mouse .
Author Moore KJ, D'Amore-Bruno MA, Korfhagen TR, Glasser SW, Whitsett JA, Jenkins NA and Copeland NG.
Journal Genomics 12 (2), 388-393 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.