• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens serum amyloid A1 (SAA1), transcript variant 2, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu20486 Homo sapiens serum amyloid A1 (SAA1), transcript variant 2, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu20486C Homo sapiens serum amyloid A1 (SAA1), transcript variant 2, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_199161.3, 295821190
Length 369 bp
Structure linear
Update Date 05-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens serum amyloid A1 (SAA1), transcript variant 2, mRNA.
Product serum amyloid A-1 protein preproprotein
Comment

Summary: This gene encodes a member of the serum amyloid A family of apolipoproteins. The encoded protein is a major acute phase protein that is highly expressed in response to inflammation and tissue injury. This protein also plays an important role in HDL metabolism and cholesterol homeostasis. High levels of this protein are associated with chronic inflammatory diseases including atherosclerosis, rheumatoid arthritis, Alzheimer's disease and Crohn's disease. This protein may also be a potential biomarker for certain tumors. Alternate splicing results in multiple transcript variants that encode the same protein. A pseudogene of this gene is found on chromosome 11.[provided by RefSeq, Jun 2012].


Transcript Variant: This variant (2) differs in the 5' UTR compared to variant 1. Variants 1, 2 and 3 encode the same protein.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_954630.1
CDS 41..409
Misc Feature(1)101..406
Exon (1)1..36
Gene:SAA1
Gene Synonym:PIG4; SAA; SAA2; TP53I4
Exon (2)37..131
Gene:SAA1
Gene Synonym:PIG4; SAA; SAA2; TP53I4
Exon (3)132..270
Gene:SAA1
Gene Synonym:PIG4; SAA; SAA2; TP53I4
Exon (4)271..531
Gene:SAA1
Gene Synonym:PIG4; SAA; SAA2; TP53I4
Translation MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNY DAAKRGPGGAWAAEVISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPE KY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
2+dbSNP:
2+a, gdbSNP:2445166
5+a, gdbSNP:78359795
6+a, gdbSNP:189750793
complement(32)-g, adbSNP:11545466
48+c, tdbSNP:11545470
49..50+c, tdbSNP:11545473
54+c, tdbSNP:372757378
56+a, gdbSNP:267602811
63+c, tdbSNP:11545474
95+c, tdbSNP:373249018
109+a, gdbSNP:146330775
119+a, gdbSNP:139332456
166+dbSNP:
166+a, gdbSNP:149926073
184+c, tdbSNP:144981113
249+c, tdbSNP:1136743
251+c, tdbSNP:11545468
256+c, tdbSNP:1136745
264+c, tdbSNP:1136747
270+c, gdbSNP:1671926
270+c, gdbSNP:28720026
283+dbSNP:
283+c, gdbSNP:368358385
296+c, tdbSNP:1059559
299+a, tdbSNP:144465925
300+c, tdbSNP:1059560
306+a, gdbSNP:2229338
309+a, gdbSNP:79681911
313+a, gdbSNP:371577716
319+c, tdbSNP:15790
321+a, cdbSNP:150951768
322+a, gdbSNP:11545465
327+c, tdbSNP:145680768
complement(328)-g, adbSNP:12218
341+a, gdbSNP:17850140
344+a, gdbSNP:1059567
355+g, tdbSNP:138257225
362..363+, aadbSNP:148453200
363+a, gdbSNP:1059571
380+c, tdbSNP:142961925
402+a, gdbSNP:61745680
439+c, tdbSNP:183981346
460+c, tdbSNP:11821600
513+g, tdbSNP:146642944
Gene SymbolSAA1
Gene SynonymPIG4; SAA; SAA2; TP53I4
Chromosome11
Locus Map11p15.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001178006 Homo sapiens serum amyloid A1 (SAA1), transcript variant 3, mRNA. In-stock $99.00 5-7
NM_199161 Homo sapiens serum amyloid A1 (SAA1), transcript variant 2, mRNA. In-stock $99.00 5-7
NM_000331 Homo sapiens serum amyloid A1 (SAA1), transcript variant 1, mRNA. In-stock $99.00 5-7
Title Effect of amino acid variations in the central region of human serum amyloid A on the amyloidogenic properties .
Author Takase H, Tanaka M, Miyagawa S, Yamada T and Mukai T.
Journal Biochem. Biophys. Res. Commun. 444 (1), 92-97 (2014)
Title Serum amyloid A: expression throughout human ovarian folliculogenesis and levels in follicular fluid of women undergoing controlled ovarian stimulation .
Author Urieli-Shoval S, Finci-Yeheskel Z, Eldar I, Linke RP, Levin M, Prus
Journal J. Clin. Endocrinol. Metab. 98 (12), 4970-4978 (2013)
Title Interaction of serum amyloid A with human cystatin C--assessment of amino acid residues crucial for hCC-SAA formation (part II) .
Author Spodzieja M, Rafalik M, Szymanska A, Kolodziejczyk AS and Czaplewska P.
Journal J. Mol. Recognit. 26 (9), 415-425 (2013)
Title Rs12218 In SAA1 gene was associated with serum lipid levels .
Author Xu XL, Sun XT, Pang L, Huang G, Huang J, Shi M and Wang YQ.
Journal Lipids Health Dis 12, 116 (2013)
Title Human serum amyloid A protein. Complete amino acid sequence of a new variant .
Author Beach CM, De Beer MC, Sipe JD, Loose LD and De Beer FC.
Journal Biochem. J. 282 (PT 2), 615-620 (1992)
Title The human acute-phase serum amyloid A gene family: structure, evolution and expression in hepatoma cells .
Author Betts JC, Edbrooke MR, Thakker RV and Woo P.
Journal Scand. J. Immunol. 34 (4), 471-482 (1991)
Title Serum amyloid A, an acute phase protein, inhibits platelet activation .
Author Zimlichman S, Danon A, Nathan I, Mozes G and Shainkin-Kestenbaum R.
Journal J. Lab. Clin. Med. 116 (2), 180-186 (1990)
Title Structure of a human serum amyloid A gene and modulation of its expression in transfected L cells .
Author Woo P, Sipe J, Dinarello CA and Colten HR.
Journal J. Biol. Chem. 262 (32), 15790-15795 (1987)
Title Human serum amyloid A (SAA): biosynthesis and postsynthetic processing of preSAA and structural variants defined by complementary DNA .
Author Sipe,J.D., Colten,H.R., Goldberger,G., Edge,M.D., Tack,B.F., Cohen,A.S. and Whitehead,A.S.
Journal Biochemistry 24 (12), 2931-2936 (1985)
Title The complete amino acid sequence of an amyloid fibril protein AA1 of unusual size (64 residues) .
Author Sletten,K., Husby,G. and Natvig,J.B.
Journal Biochem. Biophys. Res. Commun. 69 (1), 19-25 (1976)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.