• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens keratin 18 (KRT18), transcript variant 2, mRNA.


RefSeq Accession Definition Services Price Order
NM_199187 Homo sapiens keratin 18 (KRT18), transcript variant 2, mRNA. ORF Sequence $374.97
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_199187.1, 40354194
Length 1439 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens keratin 18 (KRT18), transcript variant 2, mRNA.
Product keratin, type I cytoskeletal 18
Comment

Summary: KRT18 encodes the type I intermediate filament chain keratin 18. Keratin 18, together with its filament partner keratin 8, are perhaps the most commonly found members of the intermediate filament gene family. They are expressed in single layer epithelial tissues of the body. Mutations in this gene have been linked to cryptogenic cirrhosis. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (2) differs in the 5' UTR compared to variant 1. Variants 1 and 2 both encode the same protein.

RefSeq NP_954657.1
CDS 70..1362
Misc Feature(1)73..306
Misc Feature(2)73..306
Misc Feature(3)73..75
Misc Feature(4)88..90
Misc Feature(5)97..99
Misc Feature(6)106..108
Misc Feature(7)112..114
Misc Feature(8)121..123
Misc Feature(9)157..159
Misc Feature(10)160..162
Misc Feature(11)160..162
Misc Feature(12)169..171
Misc Feature(13)169..171
Misc Feature(14)175..177
Misc Feature(15)193..195
Misc Feature(16)214..216
Misc Feature(17)226..228
Misc Feature(18)226..228
Misc Feature(19)226..228
Misc Feature(20)226..228
Misc Feature(21)226..228
Misc Feature(22)247..249
Misc Feature(23)262..264
Misc Feature(24)262..264
Misc Feature(25)277..1188
Misc Feature(26)298..453
Misc Feature(27)304..1236
Misc Feature(28)307..1230
Misc Feature(29)307..414
Misc Feature(30)367..369
Misc Feature(31)415..465
Misc Feature(32)460..462
Misc Feature(33)466..741
Misc Feature(34)598..600
Misc Feature(35)742..813
Misc Feature(36)781..786
Misc Feature(37)781..783
Misc Feature(38)781..783
Misc Feature(39)781..783
Misc Feature(40)796..1242
Misc Feature(41)814..1230
Misc Feature(42)880..882
Misc Feature(43)973..975
Misc Feature(44)1024..1026
Misc Feature(45)1060..1062
Misc Feature(46)1231..1359
Misc Feature(47)1258..1260
Misc Feature(48)1264..1266
Misc Feature(49)1264..1266
Misc Feature(50)1279..1281
Misc Feature(51)1345..1347
Exon (1)1..68
Gene:KRT18
Gene Synonym:CYK18; K18
Exon (2)69..486
Gene:KRT18
Gene Synonym:CYK18; K18
Exon (3)487..569
Gene:KRT18
Gene Synonym:CYK18; K18
Exon (4)570..726
Gene:KRT18
Gene Synonym:CYK18; K18
Exon (5)727..891
Gene:KRT18
Gene Synonym:CYK18; K18
Exon (6)892..1017
Gene:KRT18
Gene Synonym:CYK18; K18
Exon (7)1018..1241
Gene:KRT18
Gene Synonym:CYK18; K18
Exon (8)1242..1421
Gene:KRT18
Gene Synonym:CYK18; K18
Translation MSFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGS GGLATGIAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLESKIREHLEKKG PQVRDWSHYFKIIEDLRAQIFANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVEN DIHGLRKVIDDTNITRLQLETEIEALKEELLFMKKNHEEEVKGLQAQIASSGLTVEVDAP KSQDLAKIMADIRAQYDELARKNREELDKYWSQQIEESTTVVTTQSAEVGAAETTLTELR RTVQSLEIDLDSMRNLKASLENSLREVEARYALQMEQLNGILLHLESELAQTRAEGQRQA QEYEALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSNSMQTIQKTTTRRIVDGKVVS ETNDTKVLRH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
26+dbSNP:
26+g, tdbSNP:115941399
64+c, gdbSNP:79477652
75+c, tdbSNP:141170056
80+c, tdbSNP:76301931
117+a, gdbSNP:80354424
119+a, gdbSNP:79476176
122+c, gdbSNP:147350452
138+c, tdbSNP:141066547
145+a, gdbSNP:78514003
146+c, tdbSNP:11551634
148+c, tdbSNP:77825282
152+a, cdbSNP:74379840
163+g, tdbSNP:74953757
171+a, cdbSNP:78343594
181+g, tdbSNP:77999286
183+c, tdbSNP:75380684
186+c, tdbSNP:75174163
196+c, gdbSNP:75441140
203+c, gdbSNP:200221269
210+c, tdbSNP:80004568
217+c, tdbSNP:78479490
218+g, tdbSNP:11551633
232+a, cdbSNP:78718957
236+a, gdbSNP:76183244
246+g, tdbSNP:76187914
249+c, tdbSNP:186267053
262..285+, accgggatagccgggggtctggcadbSNP:267607417
264+c, gdbSNP:79913669
270+a, gdbSNP:77364359
274+a, gdbSNP:11551624
307+a, gdbSNP:199572098
321+a, gdbSNP:79346135
338+a, gdbSNP:11551641
344+c, tdbSNP:11551623
374+a, tdbSNP:144926827
376+a, gdbSNP:61136606
385+c, tdbSNP:11551638
399+c, tdbSNP:11551621
411+c, gdbSNP:11551637
425+a, gdbSNP:147945345
436+g, tdbSNP:11551629
439+a, gdbSNP:11551632
447+g, tdbSNP:140324943
452+a, tdbSNP:57758506
465+c, tdbSNP:150028481
485+a, gdbSNP:145269455
507+dbSNP:
507+c, tdbSNP:145047046
515+a, gdbSNP:200694483
517+a, gdbSNP:59979366
543+c, tdbSNP:78791501
550+a, gdbSNP:11551626
558+c, tdbSNP:77832070
572..573+dbSNP:
572..573+c, tdbSNP:17856017
581+a, tdbSNP:11551625
645+c, tdbSNP:11551628
646+a, gdbSNP:11170343
654+a, gdbSNP:115544685
668+a, gdbSNP:146788536
672+a, cdbSNP:11551622
758+dbSNP:
758+c, gdbSNP:58472472
789+a, cdbSNP:1049159
816+a, gdbSNP:191325805
830+c, gdbSNP:11551642
831+c, tdbSNP:145578755
851+a, gdbSNP:57354642
858+c, tdbSNP:11551643
896+dbSNP:
896+a, gdbSNP:61696408
923+a, gdbSNP:59112368
945+g, tdbSNP:141750671
951+a, gdbSNP:150137089
953+c, tdbSNP:267607418
959+c, tdbSNP:115810585
969+a, tdbSNP:11551636
993+c, tdbSNP:149270992
994+a, gdbSNP:199930351
1057+dbSNP:
1057+c, tdbSNP:147365823
1062+c, tdbSNP:58138700
1071+c, gdbSNP:11542066
1081+c, tdbSNP:11551635
1087+a, gdbSNP:57370769
1105+a, gdbSNP:143380812
1155+a, gdbSNP:144702029
1186+c, gdbSNP:17467
1211+a, gdbSNP:147541172
1213+a, cdbSNP:11551627
1297+dbSNP:
1297+a, cdbSNP:1063607
1301+a, gdbSNP:148580152
1304+a, gdbSNP:146080391
1305+a, g, tdbSNP:142940942
1337+a, gdbSNP:200552337
1351+c, tdbSNP:709170
Gene SymbolKRT18
Gene SynonymCYK18; K18
Chromosome12
Locus Map12q13
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000224 Homo sapiens keratin 18 (KRT18), transcript variant 1, mRNA. Full Length $430.65
ORF Sequence $374.97
NM_199187 Homo sapiens keratin 18 (KRT18), transcript variant 2, mRNA. Full Length $417.31
ORF Sequence $374.97
Title Keratin 8/18 regulation of glucose metabolism in normal versus cancerous hepatic cells through differential modulation of hexokinase status and insulin signaling .
Author Mathew,J., Loranger,A., Gilbert,S., Faure,R. and Marceau,N.
Journal Exp. Cell Res. 319 (4), 474-486 (2013)
Title The prognostic significance of the increase in the serum M30 and M65 values after chemotherapy and relationship between these values and clinicopathological factors in patients with advanced gastric cancer .
Author Bilici,A., Ustaalioglu,B.B., Ercan,S., Seker,M., Yilmaz,B.E., Orcun,A. and Gumus,M.
Journal Tumour Biol. 33 (6), 2201-2208 (2012)
Title Keratin K18 increases cystic fibrosis transmembrane conductance regulator (CFTR) surface expression by binding to its C-terminal hydrophobic patch .
Author Duan,Y., Sun,Y., Zhang,F., Zhang,W.K., Wang,D., Wang,Y., Cao,X., Hu,W., Xie,C., Cuppoletti,J., Magin,T.M., Wang,H., Wu,Z., Li,N. and Huang,P.
Journal J. Biol. Chem. 287 (48), 40547-40559 (2012)
Title A potential association between Helicobacter pylori CagA EPIYA and multimerization motifs with cytokeratin 18 cleavage rate during early apoptosis .
Author Saberi,S., Douraghi,M., Azadmanesh,K., Shokrgozar,M.A., Zeraati,H., Hosseini,M.E., Mohagheghi,M.A., Parsaeian,M. and Mohammadi,M.
Journal Helicobacter 17 (5), 350-357 (2012)
Title Properties of intermediate filament networks assembled from keratin 8 and 18 in the presence of Mg(2)+ .
Author Leitner,A., Paust,T., Marti,O., Walther,P., Herrmann,H. and Beil,M.
Journal Biophys. J. 103 (2), 195-201 (2012)
Title PKC epsilon-related kinase associates with and phosphorylates cytokeratin 8 and 18 .
Author Omary,M.B., Baxter,G.T., Chou,C.F., Riopel,C.L., Lin,W.Y. and Strulovici,B.
Journal J. Cell Biol. 117 (3), 583-593 (1992)
Title Localisation of a cDNA clone for human cytokeratin 18 to chromosome 17p11-p12 by in situ hybridisation .
Author Heath,P., Elvin,P., Jenner,D., Gammack,A., Morten,J. and Markham,A.
Journal Hum. Genet. 85 (6), 669-670 (1990)
Title Localization of the gene for human simple epithelial keratin 18 to chromosome 12 using polymerase chain reaction .
Author Waseem,A., Gough,A.C., Spurr,N.K. and Lane,E.B.
Journal Genomics 7 (2), 188-194 (1990)
Title Embryonic simple epithelial keratins 8 and 18: chromosomal location emphasizes difference from other keratin pairs .
Author Waseem,A., Alexander,C.M., Steel,J.B. and Lane,E.B.
Journal New Biol. 2 (5), 464-478 (1990)
Title Cytokeratin expression in simple epithelia. I. Identification of mRNA coding for human cytokeratin no. 18 by a cDNA clone .
Author Romano,V., Hatzfeld,M., Magin,T.M., Zimbelmann,R., Franke,W.W., Maier,G. and Ponstingl,H.
Journal Differentiation 30 (3), 244-253 (1986)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878